CAZyme Information: MGYG000001311_04172

Basic Information

• Species: Enterocloster sp000155435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp000155435
• CAZyme ID: MGYG000001311_04172
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263	MGYG000001311_108|CGC16	29838.97	5.353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001311	6514476	Isolate	not provided	not provided

• Gene Location: Start: 1165397; End: 1166188 Strand: -

Full Sequence      

MALAELNFFSYYLGMNTSVMALLPEERGMPISDDSHKKYPVLYLLHGHGDDQTGWIRKSM
LELKVRDRELIVVMPTTHRGFYINGKHGYRYFDYLAKELPRAVGNFFHGSLERKDNYIAG
LSMGGYGALYLALSCPEQYAGAAALSAAVTPGAVLDVGSRMFSVPDFRENIADCFGCPEQ
ADGSEYDLRQKCLELKKRDAADWPKIMQSIGTEDPLYPANLEFSRWLKQEMPGLEYQYTQ
AAGNHDWIFWDSQIDPVLRFFGL

Enzyme Prediction     

No EC number prediction in MGYG000001311_04172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	13	259	9.5e-47	0.9559471365638766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	6.71e-29	13	261	22	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	3.69e-18	10	261	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
PLN02442	PLN02442	6.76e-11	29	139	38	168	S-formylglutathione hydrolase
COG2382	Fes	2.74e-08	8	261	73	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0596	MhpC	8.40e-04	40	262	22	229	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDE76860.1	6.20e-18	37	258	181	404
AFK03361.1	1.87e-14	33	250	184	393
ABR43742.1	5.92e-14	30	258	160	387
QJE30861.1	5.92e-14	30	258	160	387
BBK92061.1	5.92e-14	30	258	160	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	3.47e-52	1	263	2	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	9.01e-36	1	260	9	257	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	3.03e-35	2	260	4	251	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	4.46e-34	1	260	8	256	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	9.47e-31	2	258	6	249	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	8.59e-28	1	254	1	254	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q0TKS8	2.65e-12	36	154	40	177	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1
Q8FKG2	2.65e-12	36	154	40	177	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=frmB PE=3 SV=1
Q8X5J5	4.94e-12	37	154	41	177	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
Q1RFI8	9.20e-12	36	154	40	177	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000032	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001311_04172.