CAZyme Information: MGYG000001307_04188

Basic Information

• Species: Providencia stuartii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia stuartii
• CAZyme ID: MGYG000001307_04188
• CAZy Family: GT56
• CAZyme Description: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000001307_50|CGC2	41189.38	8.0678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001307	4603561	Isolate	not provided	not provided

• Gene Location: Start: 37893; End: 38975 Strand: +

Full Sequence      

MTTLIHVLGSELPHHNQTVLTFFNDVICKENTASQKPHFMVVSRDTQLAAAYPKLNIDVF
ESKKAIANAVIQRAMADRRERFFFHGQFNAPIWLALLFGKIKSHQFWWHIWGADLYEESK
SLKFKLFYVLRRLAQKKVGHVCATRGDLCYFQQSNPKVPASILYFPTRMDPALTLNERPA
RQGETLTILLGNSGDQSNRHIEALGAIKQQFGEQVKVIVPMGYPDNNQAYIQQVEKAAQT
LFKADQVSILKERMAFADYLDLLRTCDLGYFIFNRQQGVGTLCLLIQFGIPFVISRQNTF
WQDLTAQNVPVFFYGDELSLGLVDEAQRQMTLLDKQHIDFFAPNFTDGWKTILGVAEEQA

Enzyme Prediction     

No EC number prediction in MGYG000001307_04188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT56	1	353	1.9e-163	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK02797	PRK02797	0.0	40	360	1	321	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase.
pfam07429	Glyco_transf_56	0.0	1	358	1	358	4-alpha-L-fucosyltransferase glycosyl transferase group 56. This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (EC 2.4.1.-) (approximately 360 residues long). This catalyzes the synthesis of Fuc4NAc-ManNAcA-GlcNAc-PP-Und (lipid III) as part of the biosynthetic pathway of enterobacterial common antigen (ECA), a polysaccharide comprised of the trisaccharide repeat unit Fuc4NAc-ManNAcA-GlcNAc.
cd01048	Ferritin_like_AB2	0.010	199	263	41	105	Uncharacterized family of ferritin-like proteins found in archaea and bacteria. Ferritin-like domain found in archaea and bacteria, subgroup 2 (Ferritin_like_AB2). This uncharacterized domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins whose function is unknown. The conserved residues of a diiron center are present within the putative active site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXO19491.1	4.07e-271	1	360	1	360
QIB31818.1	4.07e-271	1	360	1	360
AVE41901.1	4.07e-271	1	360	1	360
QET98517.1	4.07e-271	1	360	1	360
QPN40383.1	4.07e-271	1	360	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MYM4	2.16e-168	1	356	1	356	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=wecF PE=3 SV=1
A7FD60	1.02e-166	1	356	1	356	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=wecF PE=3 SV=1
Q66G07	2.90e-166	1	356	1	356	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=wecF PE=3 SV=1
B2K058	2.90e-166	1	356	1	356	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=wecF PE=3 SV=1
B1JPZ9	5.84e-166	1	356	1	356	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=wecF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001307_04188.