CAZyme Information: MGYG000001303_00549

Basic Information

• Species: Clostridium_AP scindens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_AP; Clostridium_AP scindens
• CAZyme ID: MGYG000001303_00549
• CAZy Family: GH68
• CAZyme Description: Levansucrase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21461.95	6.8506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001303	3619905	Isolate	not provided	North America

• Gene Location: Start: 2091; End: 2666 Strand: +

Full Sequence      

MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISHITRHDMLQIPEQQKN
EKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYHIVFALAGDPKNADDTS
IYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEWSGQPHLHLTEKSVYSTL
ISPVNITANKH

Enzyme Prediction     

EC	2.4.1.10	3.2.1.26

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02435	Glyco_hydro_68	1.98e-38	44	169	4	132	Levansucrase/Invertase. This Pfam family consists of the glycosyl hydrolase 68 family, including several bacterial levansucrase enzymes, and invertase from zymomonas.
cd08997	GH68	1.02e-24	84	165	1	74	Glycosyl hydrolase family 68, includes levansucrase, beta-fructofuranosidase and inulosucrase. Glycosyl hydrolase family 68 (GH68) consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9), all of which use sucrose as their preferential donor substrate. Levansucrase, also known as beta-D-fructofuranosyl transferase, catalyzes the transfer of the sucrose fructosyl moiety to a growing levan chain. Similarly, inulosucrase catalyzes long inulin-type of fructans, and beta-fructofuranosidases create fructooligosaccharides (FOS). However, in the absence of high fructan/sucrose ratio, some GH68 enzymes can also use fructan as donor substrate. GH68 retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Biotechnological applications of these enzymes include use of inulin in inexpensive production of rich fructose syrups as well as use of FOS as health-promoting pre-biotics.
cd08979	GH_J	2.51e-16	85	165	1	65	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT47452.1	1.54e-115	1	165	1	165
QAV85834.1	1.54e-115	1	165	1	165
QFY83559.1	1.54e-115	1	165	1	165
QAV52917.1	1.54e-115	1	165	1	165
QHH21711.1	1.58e-115	1	165	1	165

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BYL_A	5.79e-117	1	165	1	165	ChainA, Levansucrase [Bacillus subtilis],3BYN_A Chain A, Levansucrase [Bacillus subtilis]
3BYK_A	5.79e-117	1	165	1	165	ChainA, Levansucrase [Bacillus subtilis]
3BYJ_A	9.39e-116	1	165	1	165	ChainA, Levansucrase [Bacillus subtilis]
1PT2_A	9.49e-97	27	165	1	139	ChainA, Levansucrase [Bacillus subtilis]
1OYG_A	9.49e-97	27	165	1	139	Crystalstructure of Bacillus subtilis levansucrase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05655	3.17e-116	1	165	1	165	Levansucrase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacB PE=1 SV=1
P94468	1.46e-114	1	165	1	165	Inactive levansucrase OS=Geobacillus stearothermophilus OX=1422 GN=sacB PE=1 SV=1
P21130	5.39e-104	1	165	1	165	Levansucrase OS=Bacillus amyloliquefaciens OX=1390 GN=sacB PE=2 SV=1
P11701	3.06e-20	59	165	209	316	Levansucrase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=ftf PE=3 SV=2
D3WYV9	4.83e-19	38	170	206	340	Inulosucrase OS=Lactobacillus gasseri OX=1596 GN=inuGB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001029	0.926898	0.071014	0.000493	0.000319	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001303_00549.