CAZyme Information: MGYG000001300_02962

Basic Information

• Species: Faecalibacterium prausnitzii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii
• CAZyme ID: MGYG000001300_02962
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	MGYG000001300_24|CGC1	48413.9	4.9704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001300	3126983	Isolate	not provided	not provided

• Gene Location: Start: 57315; End: 58616 Strand: +

Full Sequence      

MQKFEKGFFIGAATAAHQVEGNNTNSDYWAQEQLPHSSFTEPSGIACDHYHRYEEDIKLL
ADAGLNAYRFSIEWARVEPEEGKFDPEAIEHYRKVIACCKAQGVEPIATLLHFTSPKWLI
CKGGWEAESTVEDFKKYVTYVMEQLGSELRYVCTINEANMGLQLAAISKRFRLMAEQAAK
NAAAAGKSAEGTVQVGMNFQKMMENMKFAAMENAQVFGTPQPQIFVSERTPEGDLLVLRA
HAAARDAIKAICPEVKVGLTLSLHDLQAQPGGEAFAEAAWQEEFTHYLPYIKKDDFLGVQ
NYTRTLYGPQGQLPAPEGAELTQMDYEVYPQALEHVIRKVAEAFKGDLIVTENGIATDED
ARRVAFIRQALDGVQHCIADGIPVKGYFYWSLMDNFEWQKGYAMQFGLIAVNRETMERTA
KPSLGVLGSYAEK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	429	6.4e-118	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.50e-89	1	423	1	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	2.60e-89	6	423	2	422	beta-galactosidase.
pfam00232	Glyco_hydro_1	1.58e-72	4	423	5	440	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.44e-55	1	423	2	455	6-phospho-beta-galactosidase; Provisional
PLN02998	PLN02998	8.49e-39	4	423	31	477	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB29242.1	7.40e-311	1	433	1	433
CBL02685.1	5.57e-306	1	430	1	430
QTE67958.1	1.76e-249	4	430	3	425
AHF24559.1	9.20e-246	4	429	3	435
AEN97245.1	7.27e-212	8	430	7	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	6.17e-123	4	433	7	411	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	1.89e-96	7	431	35	428	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
1VFF_A	3.62e-65	3	431	4	403	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	2.79e-62	3	423	10	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
7E5J_A	4.87e-51	1	423	3	433	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P12614	5.00e-49	3	423	10	438	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
B9K7M5	2.83e-45	1	423	1	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	1.41e-44	1	418	1	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
P22073	2.21e-44	3	423	5	431	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
P10482	3.51e-44	4	433	5	453	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995012	0.004990	0.000026	0.000007	0.000004	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001300_02962.