CAZyme Information: MGYG000001296_00842

Basic Information

• Species: Pediococcus acidilactici
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus acidilactici
• CAZyme ID: MGYG000001296_00842
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		24563.96	10.1117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001296	1929633	Isolate	not provided	not provided

• Gene Location: Start: 838578; End: 839219 Strand: -

Full Sequence      

MAKKKRRRKNNFFYQQGQLKVSSIIGLLLVVCLVVELGMKLRTEATQVTDNLTTTSATAQ
RHQQFIKTIAPYAQQMQRQYGILPSITMAQAILESDWGQSTLSKKFNNYYGIKGDSDQNS
RYFKTQEFVNGKWVTVAARFKVYSSWQESMRDHSLLLVNGTNWNPRQYQAVITASDYKQA
AQALYDAQYATDPDYPAKLINLIQKYNLNQYDK

Enzyme Prediction     

No EC number prediction in MGYG000001296_00842.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	70	208	2.5e-36	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.52e-63	54	213	35	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	6.04e-40	63	212	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.34e-36	59	212	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	2.58e-36	64	213	322	473	amidase domain-containing protein.
PRK05684	flgJ	2.31e-30	63	205	153	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS03301.1	8.99e-140	1	213	1	213
QHM55132.1	8.99e-140	1	213	1	213
QDJ22953.1	8.99e-140	1	213	1	213
QJW87345.1	8.99e-140	1	213	1	213
QYI94351.1	8.99e-140	1	213	1	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.34e-27	50	212	18	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.74e-23	64	212	62	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	3.96e-19	65	205	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.59e-19	65	205	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.32e-42	63	213	49	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	1.17e-27	65	212	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	4.20e-27	65	212	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	4.20e-27	65	212	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P37710	1.05e-23	64	212	182	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999925	0.000068	0.000001	0.000000	0.000000	0.000017

TMHMM  Annotations     

start	end
21	38