CAZyme Information: MGYG000001293_02620

Basic Information

• Species: Lacticaseibacillus rhamnosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus rhamnosus
• CAZyme ID: MGYG000001293_02620
• CAZy Family: GH38
• CAZyme Description: Mannosylglycerate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	MGYG000001293_1|CGC34	64942.18	6.3633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001293	3010111	Isolate	not provided	not provided

• Gene Location: Start: 2735019; End: 2736761 Strand: -

Full Sequence      

MVIAAHQGIKAQSGLVEQVWKTIARGQAHDSSGGCNSDVTNRDIYQRGNNALQLATSLRD
YLLRKLASSSAPSLNVFFWNPTIQSVTRTGQITVATRDKYFALKDEHGLPVTYEVLRQVQ
VDDAVLRRDKTQEKPMIYYQTTIAVPLVMKAMDWVGFTLESAQQAVPLRSDSTTIRNEYY
TLSFTNGELKLTDNRTGQSFVNPIHFDDGGDEGDTYDYSPAYQDWLINLTLEEAEVTGHQ
GKLVSELSFKGGWHLPKDLSDRAAKKANVILPYTLELKLLANDPVIHFKLTVDNNILDHR
LRLILTTPVHAQYSFADTPFGVAKRPVVDPHLNDWQAIGYHEEPTGLRPMIHFANTHDPI
TSWTFLGLGEKECQLIGQHFEQLAVTMFRGVGYLGRPDLKRRPGDASGLQTRYVPTPDSQ
LLGRQQLEGGICLDEQFNPAEIQQRVQALAIGDLSYQKQTLNRFTTPLQYFPINANQTAL
EHQPSLRLNTRDLVISSVTATSDQAGYLVRVYNPTSDSCEDPGVFEFAWLASVRLLTLNH
ETKETVATSVSHYQLTPFKAGEIRTYGIYPLNNDVAASKG

Enzyme Prediction     

No EC number prediction in MGYG000001293_02620.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	5.08e-102	14	566	322	872	mannosylglycerate hydrolase.
COG0383	AMS1	7.28e-27	19	569	358	942	Alpha-mannosidase [Carbohydrate transport and metabolism].
pfam07748	Glyco_hydro_38C	1.37e-07	175	359	1	169	Glycosyl hydrolases family 38 C-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR88570.1	0.0	1	580	9	588
AQY35742.1	0.0	1	580	42	621
QEW12269.1	0.0	1	580	298	877
BAI43096.1	0.0	1	580	9	588
ASY48608.1	0.0	1	580	268	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KBP_A	8.80e-21	17	433	341	782	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	1.80e-18	17	433	341	782	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
2WYH_A	5.60e-18	20	427	364	802	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54746	5.70e-53	8	566	317	872	Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999347	0.000684	0.000004	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001293_02620.