CAZyme Information: MGYG000001291_01835

Basic Information

• Species: Finegoldia magna_H
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Finegoldia; Finegoldia magna_H
• CAZyme ID: MGYG000001291_01835
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		25776.15	4.8722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001291	1986740	Isolate	not provided	not provided

• Gene Location: Start: 94045; End: 94713 Strand: +

Full Sequence      

MKIKNKILALTMATVMIPQISFACSNEVNEIYLKNSQISMLIEKCKEEIYRKKEVSQMIK
NVESFRNDMYSSPIYNPVHITYISSDGLNKLLENTGLENLGESFYKAEENYGINSVFLIS
LAMLESGNGYSRIAREKNNLFGYNSNDRNPYGDSFAFESKEDCIDYVAESIKRNYLSSDG
KFFNGYSIEAMNINYCSKDNWHEQIKDIMYNLYREINERDII

Enzyme Prediction     

No EC number prediction in MGYG000001291_01835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	101	211	1.2e-19	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	8.76e-17	83	220	81	236	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
pfam01832	Glucosaminidase	7.31e-13	101	176	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.18e-07	90	187	1	98	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	9.01e-05	97	162	47	109	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
COG2992	Bax	0.002	117	168	140	199	Uncharacterized FlgJ-related protein [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAG09163.1	1.51e-156	1	222	1	222
EFE28494.2	4.90e-38	83	206	110	233
CBH22484.1	1.52e-30	83	207	102	226
QKH79872.1	4.67e-30	74	216	77	219
BAG08061.1	4.67e-30	74	216	77	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	9.40e-17	81	220	147	290	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
6FXO_A	1.04e-08	83	171	73	176	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4PI7_A	2.31e-06	83	135	65	118	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	4.23e-17	81	220	515	658	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	4.31e-17	81	220	559	702	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1
Q5HQB9	5.41e-08	82	135	1163	1217	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
O33635	5.41e-08	82	135	1163	1217	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q8CPQ1	5.41e-08	82	135	1163	1217	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002031	0.668573	0.328589	0.000306	0.000245	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001291_01835.