CAZyme Information: MGYG000001275_02264

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_02264
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		46549.8	7.8908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 7623; End: 8849 Strand: -

Full Sequence      

MRALKIITGAILLTSCVGMSAAKLDENKAITYCQNQTWRTLRQVTGNGEDFTLMPRNIAN
TDSVWTLRKNSPEEWCNGFWPGVLWYAYESSNDLKLREYAEKYTETLEFLSQRPAFDHDL
GFLVFCSYGNGYRLTQNPRYKQVILATADTLATLFNPNVGTILSWPRNVEMLGGHNTIMD
NMINLEMLFWAAKNGGDHRLYDIAVKHAETTMKHHFRPDHTCYHVAVYDPKTGAFLKGMT
HQGYSDDSVWARGQAWAIYGYTVVYRETRDPKFLDFACKVTDAYLNRLPKDCVPYWDFDD
PAGKKAPRDASAAAVVASALLELQGYCDKTNQERYYKAAQKMLASLSSDKYQSREKRPSF
LDHSTGHKPAGSEIDASIIYADYYYLEALLRVKRVREHNAPLPQLALK

Enzyme Prediction     

No EC number prediction in MGYG000001275_02264.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	391	1.7e-129	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.74e-19	60	267	14	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR37845.1	7.94e-196	9	399	11	402
QQY39821.1	7.94e-196	9	399	11	402
QUT85425.1	3.22e-195	9	399	11	402
QEW35632.1	4.57e-195	9	399	11	402
QJR69439.1	9.21e-195	9	399	11	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.18e-88	12	397	14	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.06e-59	39	391	34	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.11e-59	39	391	35	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	2.96e-59	39	391	35	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.15e-58	39	391	35	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	5.83e-88	55	391	59	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9A0T3	1.33e-61	41	391	38	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.16e-58	39	391	35	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	3.04e-58	39	391	33	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	2.33e-55	57	394	26	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000969	0.411009	0.587197	0.000291	0.000288	0.000250

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_02264.