CAZyme Information: MGYG000001268_00588

Basic Information

• Species: Rothia mucilaginosa_B
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa_B
• CAZyme ID: MGYG000001268_00588
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		49571.98	9.7996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001268	1847122	MAG	Italy	Europe

• Gene Location: Start: 4980; End: 6368 Strand: -

Full Sequence      

MIRTESATPIWGKIAIAALILMVVCGYLFEILINPFGGLDFSIYRMGAMTIFDNEGFTKD
LYAPAFVEIGVLKLPFTYPPFAALVFLPFAFLPLEVGKAIMVLGTAAAAWWLSTIIYNYA
QASGRALPLQGCLGRTGTIAALTIVVMLCGPWRRTFDLMQINPLIMALVLADFVRPATRV
PRGVLIGIAGGLKLTPLVFGLILLVRRDWKGIATLGATFLTTIAVGFILLPNEAPQFWFS
AISDPSRVGDINFVDNISIQGWLMHFGLNGTALKLGFYALAALSVALVAVLLYQLERRGK
TLAQVAVTGTLMVALSPISWSHHNVLLPLLLAALILDAFPTFMVHLPSAARKVACVLAWV
AGVGLYISPRIIGGITQLGMNGLEFLWTPGVAIGGFPSFALWATVMLWAVAALTAPVRGA
QVEPVQYGSVRSDAPLGWWGARALVTGRAESVRAASSREATA

Enzyme Prediction     

No EC number prediction in MGYG000001268_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	76	317	1.6e-67	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	4.37e-31	34	325	40	317	mannosyltransferase; Provisional
pfam09594	GT87	6.58e-29	76	317	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW99221.1	3.81e-226	1	462	1	462
BAI65733.1	3.81e-226	1	462	1	462
ATF63052.1	1.03e-223	1	462	1	462
BAS19902.1	1.49e-222	1	462	1	468
QKI08447.1	2.68e-222	1	424	1	425

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R036	2.97e-29	39	336	47	353	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	2.64e-24	40	359	58	354	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	3.76e-23	40	359	70	367	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	3.76e-23	40	359	70	367	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1
P9WMZ8	2.46e-21	39	323	45	330	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
69	91
101	120
133	155
183	205
212	231
273	295
302	320
324	346
353	375
390	412