CAZyme Information: MGYG000001267_00673

Basic Information

• Species: Lancefieldella sp902373375
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Lancefieldella; Lancefieldella sp902373375
• CAZyme ID: MGYG000001267_00673
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		29387.18	7.3614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001267	1280195	MAG	Italy	Europe

• Gene Location: Start: 16835; End: 17596 Strand: -

Full Sequence      

MNDTLHYCQTDFPYRPGNHRLLTFSSMYQFNENFVLPLSHDEVVHGKCSLIQRMPGDWWR
QFAGMRALALHQMTHPGAKLNFMGNEIAQFIEWRYYEGIEYYLTEEYPTHAHQQAYIKAL
NHFYKNHPGLWQYAYDNRGFDWIDADNNEQSIISFVRHGRKPSEDLVILINFDVATHQNF
RLGMPSEGVWKEVFNSDAKEFGGSGVVNSKKLSTKPVAWNGRDYSVELSVPPLGGIVLAF
EKELPKRGKHGRK

Enzyme Prediction     

EC	2.4.1.18

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	1.28e-114	1	243	485	726	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	1.68e-108	1	246	389	633	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	3.24e-69	1	239	384	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	7.99e-64	1	234	985	1216	glycogen branching enzyme; Provisional
cd11322	AmyAc_Glg_BE	2.24e-62	1	126	278	402	Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme). The glycogen branching enzyme catalyzes the third step of glycogen biosynthesis by the cleavage of an alpha-(1,4)-glucosidic linkage and the formation a new alpha-(1,6)-branch by subsequent transfer of cleaved oligosaccharide. They are part of a group called branching enzymes which catalyze the formation of alpha-1,6 branch points in either glycogen or starch. This group includes proteins from bacteria, eukaryotes, and archaea. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV51479.1	6.17e-191	1	253	418	670
SDS01908.1	3.88e-125	1	247	404	651
ADK68798.1	3.85e-124	1	253	405	658
QUC03504.1	1.09e-122	1	253	409	661
QOY61640.1	6.21e-120	1	249	460	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	2.22e-62	1	241	384	619	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
6KLF_A	2.96e-59	1	241	511	750	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.40e-59	1	241	535	774	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR1_A	4.40e-59	1	241	535	774	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	4.40e-59	1	241	535	774	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	4.01e-77	1	236	389	623	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q0TQ16	2.30e-74	1	238	418	656	1,4-alpha-glucan branching enzyme GlgB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=glgB PE=3 SV=1
A0Q593	4.37e-74	1	242	399	640	1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. novicida (strain U112) OX=401614 GN=glgB PE=3 SV=1
Q0BN67	2.38e-73	1	242	399	640	1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain OSU18) OX=393011 GN=glgB PE=3 SV=1
A4IZK2	2.38e-73	1	242	399	640	1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain WY96-3418) OX=418136 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999901	0.000081	0.000030	0.000002	0.000000	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001267_00673.