CAZyme Information: MGYG000001265_01972

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_01972
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		31558.64	8.2826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 487; End: 1389 Strand: -

Full Sequence      

MSAERYNEALKRVLVHEGGYVNDPRDPGGATMKGVTQRTYDGYRKRLGLPSRPVSQITSA
EVGEIYRRQYWAAVRGDELPAGIDYVLFDGAVNSGPVQSIKWLQRALGVSVDGVLGEATV
AAAEAYPDHDALVAAILARRLAFLRSLKTWGAFGKGWGRRVAEVQAIGQAWATGSVGPQP
TYVAGMERRGLLSDARTVPGRGFADATTGGGVISAAISQVTDLLNPLADKLPQVSTALTV
LTAVGAVLAAAGIAYRLWANSRQKALDDALDRTPVAANDNAAAAAEAEPEPPAPEQRAAA

Enzyme Prediction     

No EC number prediction in MGYG000001265_01972.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	10	95	2.2e-28	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	9.91e-64	5	210	4	210	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	1.77e-39	5	95	2	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	1.27e-38	10	95	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	6.26e-04	100	160	3	74	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOO81673.1	1.46e-94	1	271	1	276
QIW87529.1	1.29e-92	6	270	5	268
QBQ72055.1	6.90e-90	4	270	3	268
AEG54013.1	1.09e-89	1	274	1	282
ASY64488.1	1.58e-89	3	274	2	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	2.13e-36	1	175	1	173	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2IS5_A	5.23e-32	2	163	2	157	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	7.56e-32	3	163	2	156	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
2NR7_A	5.53e-09	10	147	11	152	StructuralGenomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83 [Porphyromonas gingivalis W83]
6V3Z_A	5.84e-09	7	130	23	135	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
237	259