CAZyme Information: MGYG000001265_01393

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_01393
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		86298.79	6.7044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 2729; End: 5062 Strand: -

Full Sequence      

MAGNEPTATAARHHAEEPVARHGFQDADEVLPQYHIEAQTSLVERPLRSLKFGEAFAVLD
SYGDIGVLPGPEGLYFQDTRYLSRLHFTIEDQRPLLLSSVMQDDNGALSVDMTTPDIRID
AHDESTIPREVIAIERTKFLFRGACYDRIGLRSYDSRERTLRVTLTFDADYRDLFEVRGM
DRPVRGKRSVQVASDKEVQFRYVGLDDMVRTTAVHFGPKPRHIEPGKAEFQVHLKPGGRA
SLFVRIVCESHRAFTSAPAAEKVGEDAAAGLAAASGSNAARLPRDLPEGVAFARAYRDAR
RDLRAMTAGITTVISSNDQFNEAACRATADLYMLASRTPEGIYPFAGIPWYSTVFGRDGI
ITAMMALWIDPNFAKGVLRYLASTQAKAVDPAADAQPGKVLHETRRGEMAMLGEVPFRHY
YGTIDGTPLFVMLAWEYYAITGDRETIARIWPALELALAWMNEYGDRDGDGFVEYARDTD
KGLENQGWKDSHDSIFHADGQLAKGPIALCEVQGYVYAAKNGMGKLAAMLGHDALAERLG
HEARSLRESFDKAFWNEEIGTYVLALDGEKRQCAVRSSNAGHALFTGIALPERAQAVAAQ
LLSKDGFNGWGVRTIARGEARYNPMSYHNGSIWPHDNAVIALGLARYDLKPEASRIFEGM
FDTALYQDQKRLPELFCGFMRRRQRGPVSYPVACSPQAWAAAAPFAFLAACLGLELDHGR
NRIRFRNPTLPNFLEAISIFNLKLGDSRVDLRLERHADDVTVKVLRRVGDAQVALLK

Enzyme Prediction     

No EC number prediction in MGYG000001265_01393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	364	609	7.6e-20	0.39285714285714285

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	9.63e-116	71	751	40	640	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam14742	GDE_N_bis	5.33e-67	50	245	1	193	N-terminal domain of (some) glycogen debranching enzymes. This domain is found on the N-terminal of some glycogen debranching enzymes and is usually followed by the GDE_C (PF06202) and in this sense it is analogous (but probably not homologous) to the GDE_N (PF12439). Its exact function is unknown
pfam06202	GDE_C	3.16e-14	346	634	23	301	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17389	Bac_rhamnosid6H	5.66e-11	420	605	93	254	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	1.22e-10	425	562	99	215	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWN42065.1	0.0	1	777	1	777
ACB25132.1	0.0	9	777	6	781
APT31854.1	0.0	9	777	6	781
AWV16838.1	0.0	9	777	6	781
AIQ91289.1	0.0	22	777	3	759

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_01393.