CAZyme Information: MGYG000001258_01229

Basic Information

• Species: Rothia sp902373285
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia sp902373285
• CAZyme ID: MGYG000001258_01229
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		46384.12	5.8771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001258	2162110	MAG	Italy	Europe

• Gene Location: Start: 34528; End: 35802 Strand: +

Full Sequence      

MNSQPSSHTAHSPASVSEYAERTSSHAEAAAVSVTDTFVHRILGVPGALIGFIQVPDPRP
LSQRLNTWHYWWQAHLLECIIDAGQRHLREGRITEAQEQLHRARSLLRGINVRNLGRYAN
DYFDDMAWLTLAVGRMNSFSIELTGANDVAAQDAGAALFEQLAKGFAPGGGMSWRKSKRD
FVNVAATAPAAIAYARAGDPHTAAALMDWMNATLWDAERSLYIDGVNVRGEEGEEHEYER
GEYTYNQGTALGALLTLAASGVPCEVDPIEQAERLIVGIVKHMTEEVEFVSGARRRILIS
HGDGDGGLFTGILVRYLGMAASSPLLSDEARALASNLIYSTARALWEGRREFDPNLPMNE
LGIDPNEIRGKALVQFSPRFTQATSEALKPGAPVELSTQLQAWTILEAAARLAHTRDIAS
HRGY

Enzyme Prediction     

No EC number prediction in MGYG000001258_01229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	64	354	9.3e-56	0.7625698324022346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	8.71e-38	27	410	3	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI65589.1	1.21e-265	1	421	78	495
QXW99112.1	5.43e-264	1	421	1	418
ATF62942.1	7.71e-264	1	421	1	418
BAS19786.1	1.81e-262	1	421	1	418
BAV86349.1	2.54e-149	33	412	31	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	4.58e-25	66	412	84	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.03e-23	66	412	85	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	6.49e-23	66	412	85	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.54e-12	66	350	41	303	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999922	0.000100	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001258_01229.