CAZyme Information: MGYG000001255_02033

Basic Information

• Species: Faecalibacterium prausnitzii_F
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_F
• CAZyme ID: MGYG000001255_02033
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		33467.79	6.2352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001255	2423712	MAG	Austria	Europe

• Gene Location: Start: 2030; End: 2974 Strand: -

Full Sequence      

MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKDITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKAGQAIAAYVDS
ARAAFSRVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRASTQYYHACEIAGDIDFI
FGGADALFEHCTLRTVDNGLAHSWVTAPSGAADGLGFVFWDCDFVSDCPAGSVYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAAARGGWVKQLDSAQA
ADLLKRARKLCRPE

Enzyme Prediction     

No EC number prediction in MGYG000001255_02033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	305	2.2e-77	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.84e-51	6	269	87	363	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.42e-48	6	272	4	251	Pectinesterase.
PLN02773	PLN02773	1.65e-44	4	275	7	260	pectinesterase
PLN02745	PLN02745	8.79e-37	6	272	289	536	Putative pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	1.48e-36	2	268	69	318	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	1.71e-221	1	314	1	314
CBL01447.1	1.71e-221	1	314	1	314
AXA81880.1	3.05e-184	1	314	1	314
CBK98674.1	5.04e-183	1	314	1	314
QIA44050.1	7.92e-177	1	313	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.92e-25	6	265	7	249	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.34e-24	6	289	11	277	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.08e-21	4	242	35	272	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	6.63e-17	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	8.37e-15	12	284	17	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.69e-35	4	277	7	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	5.08e-28	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q8VYZ3	1.14e-27	12	304	94	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O49298	1.37e-26	6	289	253	512	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9SMY6	1.67e-26	5	272	298	547	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001255_02033.