CAZyme Information: MGYG000001254_02323

Basic Information

• Species: TF01-11 sp900759665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp900759665
• CAZyme ID: MGYG000001254_02323
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	MGYG000001254_29|CGC1	93110.22	8.1365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001254	3113115	MAG	Austria	Europe

• Gene Location: Start: 16650; End: 19262 Strand: +

Full Sequence      

MKKMQKIWVSWLLVFAMVLTGLVLPDGAVTKAAETSCDLTVKEGASPVVMVKNEYGDDYI
ADILFDVPDAISTQSKVQAGSPTVTVVMKINSISSDTGSVRAMLYSQDGTYNWNQGEAVD
VAAGREITVSYNMSGITWKDSTLAKLGLRFADNAQNHSSISYTITSAKVTVQSTDNGGSA
GGGAGEATEDGLAPDAREDASKYSVSTSENRQSDGYWLEDTFSVTNHTAEKVSKIQIVLP
VSGEPKDLKCFDGMSAVYNRSVGGLIMYFSGEIAAGAKADLPGKLCFNPSGVTVSSAYVR
AVNCNPPSGEGTDAGKLNYALTGQTKEIPYEETPFGKHGKLHLKKVDGYGNAPVIVDEND
NPYQLRGASTHGLQWDEGYKFANKGTMQCLRDEWGVNLFRLAGYVKEGGYTEGGQARIDE
KINECVEAAKELGMYVIVDWHVLTGNPNETKPQAEEFFRKYAEKYKDYGNVIFEICNEPT
GTQWYNNGSGNDLYTYCKDIAQIIRDQGSDALIICGTNNWSQDVDDVAKKPLAEDGFENI
MYTFHFYAATHGDNLRQKVKAANQAGTPIFVTEFGICSADGNGNFDTANADTWIKLFDSM
NTSYTCWSLSNKSEAASYLKSSCTKTTGGYVETDLATTAIWLINTYRAHQDVEDGTDTGV
TPKPGVSADPSASVLPDQPGTSKDPASSAAPGQPDHPQNPSGSASPRQTDHPQNPSVSVS
PGQPGLSSGTASGTSGTTKPGTSAQPGTSQTPSGVQTTAKPGTATGSNGSGLNGSVQPGG
ENNTGVNGQKFVRLKKKVLKIKKGKKAKIRIKKKMPGDKVKRYKITKGKKYIKVTSKGVV
KGRRKGKAVVKVIMKSGASASCRIIVRNKR

Enzyme Prediction     

No EC number prediction in MGYG000001254_02323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	359	604	3.9e-80	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.78e-57	356	613	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.17e-07	393	613	84	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
PHA03247	PHA03247	7.50e-07	662	781	2734	2861	large tegument protein UL36; Provisional
PHA03247	PHA03247	2.12e-06	651	780	2697	2826	large tegument protein UL36; Provisional
NF033913	fibronec_FbpA	2.57e-06	663	764	192	298	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC06196.1	1.30e-131	313	661	7	352
AGH41463.1	1.84e-129	276	661	186	559
AGH40913.1	1.42e-121	316	662	65	412
AAC06197.1	2.01e-121	316	662	46	393
CBK74991.1	2.63e-119	320	664	32	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.00e-76	333	636	5	290	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	5.77e-72	332	636	28	314	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
1A3H_A	1.27e-68	337	636	5	287	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	1.39e-68	337	636	8	290	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1H5V_A	1.43e-68	337	636	8	290	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	2.82e-71	332	651	33	334	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	2.70e-70	355	642	54	331	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P10475	3.70e-69	332	636	33	319	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	1.25e-66	332	664	33	348	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
O85465	1.28e-66	337	636	34	316	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000425	0.998729	0.000303	0.000199	0.000165	0.000165

TMHMM  Annotations     

start	end
7	29