CAZyme Information: MGYG000001237_01335

Basic Information

• Species: UMGS1600 sp900553295
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553295
• CAZyme ID: MGYG000001237_01335
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41105.89	6.3777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001237	2708995	MAG	Austria	Europe

• Gene Location: Start: 2778; End: 3875 Strand: -

Full Sequence      

MPMTPLAFIDQYLARYQSHNPALWNYEDGCVLTGCRQLYQATGEEKYLRFVLDYLDARVA
ADGTIPTFDTGNYNIDAINCGKALFLAWDATGEEKYRKALDFHARRLAGHPRCVCGSFWH
KEIYPWQVWLDGLYMAQPFAMEYETRFGGRAGYGDILRQFRNARTYLYDPAKGLSYHGWD
ERRQQPWSNPGTGCSPNFWSRAMGWYLMALIDAVEACDPAIYEVYRALCDQFREAVRGIL
PYQDAATGMIYQVIDRPDVPGNYLEASGSAMLACAILKGVRLKVLLADKYLPHGLLPYET
LTRDYLRTDAAGQCHLEGICSVAGLGPGNKRDGSVAYYLSEKVVADDPKGVGAYMMATAQ
KIMLP

Enzyme Prediction     

No EC number prediction in MGYG000001237_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	19	359	7.7e-100	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.56e-86	3	364	6	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.17e-72	24	364	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93648.1	2.64e-127	8	364	9	364
QHQ62178.1	8.92e-124	8	364	11	365
BCJ96410.1	5.30e-122	8	364	9	364
CBL00657.1	7.07e-121	13	362	30	378
AXB29657.1	1.00e-120	13	362	30	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.55e-92	24	358	23	355	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.34e-60	24	360	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.93e-60	24	360	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	6.09e-14	24	285	47	305	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.28e-59	24	360	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.54e-42	135	364	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.54e-42	135	364	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.55e-21	24	282	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000097	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001237_01335.