CAZyme Information: MGYG000001232_00478

Basic Information

• Species: Peptacetobacter sp900550335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter sp900550335
• CAZyme ID: MGYG000001232_00478
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001232_24|CGC1	55801.56	4.4637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001232	2161926	MAG	Austria	Europe

• Gene Location: Start: 1243; End: 2688 Strand: -

Full Sequence      

MNIEEFREVWEENKGLRELAANDKDRLNYHIMPTSGWVNDPNGLCQFNGVYHIYYQYSPF
DVNGKLKLWGHITTEDFVKYQEHEPVLYPDYRYDQNGVYSGSAVVRNGKINYFYTGNVKH
LDGDYDYIMTGREQNLIACSSEDGFNFSEKELIMTNTDFPSKLSLHVRDPKVYPKNGVDY
MVLGARDDNSTGCVLVLKGNDLKDWECHTIIYSDEKFGYMWECPDLFDLNGETVLVTCPQ
GVPEEGYIYKNVHQNGYFIMSGDLESKDVKLSRFRLFDYGFDFYAPQTFEDESGRRILVG
WMGIPDADYTNRTTENGWQHALTMPRELILKNGIIYQRPVEEIKALRGNNRTFTSEEFKD
LEVENLSFELCAEFEKCNEFKLNLRNDVSLSFDKSKGLIELNMGESGCGRDVRYAYCDEV
RNIDVYSDISAFEIFINDGEIVFTTRAYTDYAQKIGFEKLDGLAKVCMYDMKKIVFGIDE
F

Enzyme Prediction     

No EC number prediction in MGYG000001232_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	339	1.5e-89	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	3.77e-152	36	332	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.57e-146	14	450	2	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.08e-133	1	450	3	460	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	2.26e-106	30	439	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.03e-103	30	339	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK20327.1	0.0	1	481	1	481
QQQ86052.1	0.0	1	481	1	481
QNM14308.1	2.50e-190	1	474	1	474
SOB72997.1	1.45e-170	1	475	1	496
AQP38736.1	3.26e-168	5	466	12	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	9.87e-69	9	448	7	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	2.48e-63	16	459	23	474	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	4.97e-62	17	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.26e-61	17	450	40	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	5.45e-52	28	455	5	412	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.89e-99	7	448	10	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	4.37e-89	16	472	24	490	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.25e-81	23	474	34	476	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P27217	8.36e-81	20	457	21	447	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	8.36e-77	20	457	21	447	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001232_00478.