CAZyme Information: MGYG000001219_00015

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56
• CAZyme ID: MGYG000001219_00015
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1341		144978.17	4.9687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001219	2541038	MAG	Austria	Europe

• Gene Location: Start: 15640; End: 19665 Strand: +

Full Sequence      

MLRIKDFKKVGEVTMRRKRTKKAGIFLTLVLALGVTGGTAVCAADVGVTDLADKGTEAPE
AWGAVPSPNQYRYQKDELAAFCHFGPNTFSGVEWGEHYGNTHPRDLFTLSEDFDAETMVR
SMKEAGFKKLIITAKHHDGFCLWASDYTDYDVANTNYKNGQGDILAEISAACTKYDMDMG
LYLSPWDIHEPSYGYYDANGNATTKENDVLDYNDYYNNQLQEILGNEKYGNNGHFVEVWM
DGAKGSGANAQDYDFQRWFATIQANEGLEAGYDDDCMLFGAEAYTTVRWIGNELGLANEE
TWSKSKTDKKQNTIDSNRTGSNGTTVGFADGNQWTVPEADSRITSGWFWGNNKKTPKSVA
ELANMYFNSVGHNATLLLNIPPNNQGKVDQEILDRMLEFGQNVKDSFADNLAKNAAVTAS
EVRGNDIAFAPENVIDGDDDTYWTMEDGSTTGSLTLNLGGTKTFDMVTIEEAIQLGQRIS
SFCVEYRVGNGEWKNFAEGTTIGAKRICRNSAVKASEVRISITGSYAVPLISEVGVYKAT
EGFEIGSTVPDGLEVINVTDKDTSDGAGFAYSGWTAESGPQFIDGNAMWANAGKEATLTF
HGSKVWLYGTKDSGHGTADIYIDGEKADSINTQSSPRETGVLIYESPDLADGPHTLRIVN
TGTIGLNAAAVLNNGGKGMIEFDIRTLDMEEDTEAEVVVRRVGGSTGEVKAIYENNPGSA
VQGDYDVDGIGGEIVFANGETEKTVKIRTMRDDRVKGDIGFTVDLISAEAGAVLGFQTTI
KVTIHDLDDPVRIEEAKATLEETQALLTNTSEELPEVRKLAKELSAYLAAREKTEIISVG
DIVKLAKKLEEAVGGVELKFELPVGSEVKAVEAEAFLLDASQAVDQANKYVRYQENSNAS
GGKEVNWFEQGNRIYLPFTAPKAGIYKVTATYRSGRGESNPNALVWSGTNVAAGSKDVYG
EEGAGAFHTAELNIEVTQAGDGELSFTADSKGGPVLDKFVIECVDKTPVAPIAVTGVTLE
EENLTILRDKPYALVLATVAPVNAGNQEVTYTSSNPEVATVDENGMVFGIKSGRTTITVT
TADGAKTAQCQVTVKMFEVESVSLNMAEAILTKKDQSVKLVAKVLPEEAINKEVAYTSSN
PAVATVDKDGLVKAVANGETIITVTTADGAKTAQCRVTVKIQEEIKPDPDKLPKGVIKEG
LEETVGSGRYQVINAKNKTAKLVSVMNRKAMKLNVPATVKINGVTCKVIEVCAKVMKGNT
RLKKVILGKNVAKIGKQAFSGCKNLKMVQMKGKALKTVQSGAWKNTHAKMVVSAKKMAKR
QKAALFKKLKRAGMSKKGKVK

Enzyme Prediction     

No EC number prediction in MGYG000001219_00015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	64	403	9.6e-63	0.8757225433526011

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.34e-74	63	537	8	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.01e-30	66	401	17	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.17e-29	66	400	18	327	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG5492	YjdB	1.10e-20	1010	1175	177	329	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	3.48e-13	1015	1092	1	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PLT74914.1	2.97e-314	16	1001	4	1005
QHB23055.1	1.81e-312	16	1029	4	1035
QEI30547.1	1.81e-312	16	1029	4	1035
QRT29448.1	2.61e-312	16	1029	4	1035
QPK81604.1	1.20e-305	56	1004	43	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TR3_A	1.20e-246	57	585	19	552	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	1.90e-245	57	585	19	552	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]
6ORG_A	1.70e-110	63	538	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	2.24e-109	63	538	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	2.32e-109	63	538	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	4.61e-93	65	537	37	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.79e-89	29	545	5	482	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P33747	6.83e-13	1012	1179	35	201	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2
P85991	9.63e-11	1010	1094	173	257	Ig-like virion protein OS=Serratia phage KSP90 OX=552528 PE=1 SV=2
P0DTR5	3.69e-08	574	672	849	948	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.043013	0.950336	0.004821	0.001172	0.000350	0.000296

TMHMM  Annotations     

start	end
25	47