CAZyme Information: MGYG000001218_01726

Basic Information

• Species: RUG11247 sp902767315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; RUG11247; RUG11247 sp902767315
• CAZyme ID: MGYG000001218_01726
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251	MGYG000001218_132|CGC1	28668.34	5.1487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001218	2482002	MAG	Austria	Europe

• Gene Location: Start: 2150; End: 2905 Strand: +

Full Sequence      

MAQIRCNFLSYTLRRAVDLTVIIPTMCFSEMMAENPHHPQGAKYPVLYLLHGYGNNHATW
NGYTSVELYAEERNMAVVMLSAENKAYINHGGDDNYFDFISKELPEFIQGMFPVSSRPED
TYIAGLSMGGYGALVHGLSQSQRFAAIGSFSGAAKVCDDREFQFSPAKLAEACAREDRKK
PMYIACGDQDFLYQDNIAFKDYLEKLGFDVTWVVGEGYTHEWRFWNREVEAFLDWIPRTD
AYYNGGEKRKI

Enzyme Prediction     

No EC number prediction in MGYG000001218_01726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	236	1.6e-48	0.8898678414096917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.87e-33	15	238	24	310	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.48e-19	38	225	18	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.48e-16	36	233	90	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	4.68e-07	26	234	32	271	S-formylglutathione hydrolase
pfam02230	Abhydrolase_2	2.79e-06	39	236	9	213	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL47921.1	1.73e-18	36	232	66	272
QJW94048.1	1.48e-17	36	238	82	292
ADF53787.1	1.56e-17	7	232	160	387
BBE16008.1	2.00e-17	36	236	67	277
ALR29593.1	2.02e-17	36	232	65	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	6.40e-46	1	237	2	262	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
2UZ0_A	9.45e-36	33	237	30	253	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]
4ROT_A	8.20e-35	1	237	8	258	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
7L0A_A	1.92e-34	1	236	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	9.13e-34	2	236	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	4.27e-29	1	238	1	263	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
D5EXZ4	4.24e-12	43	233	464	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	1.29e-09	36	233	73	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
Q8X5J5	3.75e-06	36	151	35	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
Q0TKS8	9.15e-06	36	151	35	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990493	0.009506	0.000017	0.000009	0.000007	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001218_01726.