CAZyme Information: MGYG000001193_00456

Basic Information

• Species: UBA4285 sp900545225
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA4285; UBA4285 sp900545225
• CAZyme ID: MGYG000001193_00456
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000001193_2|CGC1	39510.85	9.5593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001193	1467080	MAG	Austria	Europe

• Gene Location: Start: 26088; End: 27161 Strand: -

Full Sequence      

MSERRRRIIMTGGGTAGHVMPNIALLPELRARNYAIAYIGSEDGIEKDLIKGQHIRYYGV
KSGKLRRYFSLKNFTDPFKVIHGYNQAKKLLKKMKPDVVFSKGGFVSVPVVMAAGKLKIP
VIIHESDMTPGLANRIAIKRASIVCTTFPETLKYISEDKHPVLTGTPIREELLVGSAAAG
HRFTGLSSIKPTILVMGGSTGAVALNEALHANLDALLKKYNIVHLCGKDKADRRYDGTPG
YVQYEYIDKEMKDLLAMSDMVVSRAGANAIFEFLALKKPNLLIPLPAASSRGDQILNAKS
FEESGYSRVLYEDDITPESLLESIEYVFNNRDAYIKNMAESEQRDAIGKIIELIESV

Enzyme Prediction     

No EC number prediction in MGYG000001193_00456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	342	3e-39	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	1.76e-145	6	357	2	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	2.27e-142	6	357	2	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.93e-116	7	354	1	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.66e-110	6	357	1	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.80e-98	6	354	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44674.1	1.45e-153	6	357	2	352
BCJ97020.1	1.68e-152	6	357	2	352
QHQ60226.1	1.59e-150	6	357	2	352
ACR71089.1	6.44e-150	6	355	2	350
BCJ92484.1	2.61e-149	6	357	2	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.05e-40	3	357	7	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.15e-35	1	324	2	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.17e-35	8	310	5	304	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z1B5	1.29e-150	6	355	2	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1
A9KK83	5.22e-143	6	357	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
B1KYH7	1.92e-140	6	355	2	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Loch Maree / Type A3) OX=498214 GN=murG PE=3 SV=1
Q893R7	6.29e-140	5	355	2	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
B1IKH3	7.77e-140	6	355	2	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Okra / Type B1) OX=498213 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001193_00456.