CAZyme Information: MGYG000001180_02127

Basic Information

• Species: Muribaculum sp001701195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp001701195
• CAZyme ID: MGYG000001180_02127
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		33504.46	4.7035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001180	2921277	MAG	Austria	Europe

• Gene Location: Start: 261958; End: 262830 Strand: -

Full Sequence      

MRLISEFFRIFADIIYSIINLMETNKVLYISQEITPYLPDSPMAELSQKLPQGIQEKGNE
VRTFMPKYGCIKERRNQLHEVIRLSGLNIVIDDSDHPLIIKVATLQPARMQVYFIDNEDY
FLRGQTAKDLETRLSPEDNDERIMFYVRGVAETVKKLRWDPTLVHCSGWVSALAPIYLKK
IYVEDPAFQNAKVVYSLFDDKFEGTLDERMMEKLKLEGFSDKDLASIAGNPVDWKALNKL
AIDYSDGIIQASPEIDPELKEYIEKSGKKFLPYPGEEGYVDKYAEFYAQL

Enzyme Prediction     

No EC number prediction in MGYG000001180_02127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	26	259	4.6e-40	0.4661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	4.53e-43	27	253	1	218	Starch synthase catalytic domain.
PRK14098	PRK14098	2.31e-39	26	214	7	195	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	3.90e-27	26	253	1	217	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	6.90e-22	26	196	2	152	glycogen synthase GlgA.
COG0297	GlgA	2.06e-19	26	204	2	171	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35816.1	8.15e-167	22	290	1	269
QQR09950.1	3.28e-139	22	290	1	271
ANU62712.1	3.28e-139	22	290	1	271
ASB36792.1	3.28e-139	22	290	1	271
QCP71410.1	3.28e-123	22	290	1	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNF_A	9.05e-07	26	235	23	241	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]
6GNG_A	1.26e-06	27	224	42	245	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	6.41e-40	26	220	7	201	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	1.72e-39	26	220	7	201	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	4.62e-39	26	214	7	195	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	4.62e-39	26	220	7	201	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
Q3APL6	4.61e-38	25	214	6	195	Glycogen synthase OS=Chlorobium chlorochromatii (strain CaD3) OX=340177 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000030	0.000006	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001180_02127.