CAZyme Information: MGYG000001180_01816

Basic Information

• Species: Muribaculum sp001701195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp001701195
• CAZyme ID: MGYG000001180_01816
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000001180_40|CGC1	35169.3	5.0444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001180	2921277	MAG	Austria	Europe

• Gene Location: Start: 23902; End: 24870 Strand: +

Full Sequence      

MKSTVIFVISLLLAMGSATAAEEVKYDITVAQDGSGDFTTIQEAINSVPDFRKKARTTIF
IKKGVYKEKLIIAPCKINLTMTGEDGAVITYDDYASKLNRFGDEKSTSGSASCYIYAPDF
IAENLTFENSSGAVGQAVACFVSGDRAVFRNCRFLGCQDTLYTYGVPSRQYYEDCYIEGT
VDFIFGKSTAVFNRCTIHSKGKGYVTAPATEEGAAYGYVFHDCTLTGADGVENVYLSRPW
RPYAQAVYINCNLGGHIAAAGWDHWGKESNKETAYYAEYNSTGAGANPSARVPYSRQLTD
ASRYEIEKVLAGDDGWNPLSAQ

Enzyme Prediction     

No EC number prediction in MGYG000001180_01816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	307	3.2e-103	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	2.14e-84	28	311	7	292	pectinesterase
pfam01095	Pectinesterase	1.33e-80	27	313	1	298	Pectinesterase.
PLN02682	PLN02682	2.68e-72	26	300	69	349	pectinesterase family protein
PLN02432	PLN02432	1.67e-67	28	316	13	291	putative pectinesterase
PLN02665	PLN02665	4.53e-66	20	301	62	343	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41759.1	1.69e-184	11	319	11	318
ALJ61265.1	1.11e-159	26	319	284	577
QUT93206.1	1.11e-159	26	319	284	577
QDO69180.1	1.80e-158	26	319	284	577
ASM67829.1	7.37e-152	26	319	237	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.23e-49	30	312	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.89e-44	27	294	8	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	5.53e-40	28	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.06e-39	26	318	4	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	2.99e-39	28	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.73e-65	28	300	7	284	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.66e-56	25	300	82	363	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	1.16e-51	23	305	268	559	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O49298	3.77e-51	25	313	248	540	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q42608	4.96e-51	23	305	255	546	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999113	0.000163	0.000167	0.000153	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001180_01816.