CAZyme Information: MGYG000001172_01450

Basic Information

• Species: Fusobacterium sp000235465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium sp000235465
• CAZyme ID: MGYG000001172_01450
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001172_69|CGC1	44767.49	9.8471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001172	2065216	MAG	Austria	Europe

• Gene Location: Start: 5888; End: 7027 Strand: +

Full Sequence      

MKNFFKRINRIFQDYMREKRLKIGKAIWDKKEKTNIVKGDNFIKDNNIKSILFLRYDGKI
GDMIVNSLIFREIKKVYPDIKIGLVARGAAIDIVKDNPNIDKIYEYQKDRKKIKDLALKI
KEVKYDLLIDFSEMLRVNQMMLINLCGARINIGLDRKDWKLFDLSIESDKDFKWTEHITN
RYLAYLIKLGLKKENINISYDIYLKDEKKYEAFFNEIKENKKLILNPYGASKHKSFNIKT
LENIINYLKDRDIAVILVYFGDKYKELEFLEKKYKYVYMPQKIESILDTAILIKKSDYVI
TPDTSIVHIASALNKKMITVYPPKGGKYGVDHLVWAPNSDYTRVIFCKDKSGSYDEIDIN
TFDLKEMKEEILKLINNSV

Enzyme Prediction     

No EC number prediction in MGYG000001172_01450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	115	324	8.9e-24	0.8133333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.55e-59	48	378	1	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.71e-37	50	345	1	240	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	5.42e-10	51	340	10	301	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	1.12e-05	116	340	4	222	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALQ36339.1	1.59e-248	1	379	1	379
CKG84949.1	1.30e-247	1	378	1	378
QYR65365.1	5.30e-247	1	378	1	378
ASS39697.1	2.16e-246	1	378	1	378
ALF21256.1	3.06e-246	1	378	1	378

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	3.40e-13	48	361	40	341	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2
Q57336	9.00e-08	49	321	9	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	4.90e-06	61	375	5	318	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999943	0.000113	0.000004	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001172_01450.