CAZyme Information: MGYG000001167_01333

Basic Information

• Species: CAG-1427 sp000434775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp000434775
• CAZyme ID: MGYG000001167_01333
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000001167_9|CGC1	93044.42	5.0081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001167	1564270	MAG	Austria	Europe

• Gene Location: Start: 142666; End: 145104 Strand: -

Full Sequence      

MGSSIEFGLICRDAGKVFIRATSSVIPEGHELKVESQIAGKKRPCLLFLDEAKNDNIDKI
SWIVVAPQYVKQNLVFSLVDSKGVIISSQEKTLSLEKVKWVSRYNYRANREAAFEIRNYD
TERDFDLVRIDLYECISDGEKDIFHGALHIQNDIKNTVELQCCSETGEVISSDFVYMGER
EETLASYSFRKYRKIFFSIKVNKNAHLRVFQVLDTDSGELLRGFKAIEHDQYEKIEKESE
LYSLNAQVDPGYHQWFIERRATPIYVKAQREYCFSQKNKFSIIVPLFKTPLNFFDEMVAS
VKGQSYEDWELVLVNASPEDLALAQRANEETKKDSRIKVVTLESNLGITLNTNKGVEAAT
GDFVCFFDHDDILEPDLLFEYARAIESDSEIDLLYCDEDKLLEDGFYSQPFFKPDFSIDL
LRNNNYICHMLTVRKSVLDSLPKAGSEFDGAQDHNLTLKVAEVARVIHHVPKVLYHWRMS
ASSTAANADSKPYATIAGIKAVSDHLERLGIMAKVEQSRRPFTYKITYDVAGEPLVSIII
PSKDAVNLLDTCIKSIIEKTTYANYEIVIIENNSTDEKTFDYYDEITSRYEFVRVIKWDY
EFNFSKLMNFGAKHANGEYLILLNNDTELLSADWIERMLGICQRKEVGIVGVRLLYKDDT
IQHAGLCVTGGVAGHLNRALPKGNWGYFALTDAEQNFSAVTAACLMVQKSLFNEVGGFTE
ELAVAFNDVDFCLKVRESGKLIVYTPEVELYHYESISRGEEDSLQKKIRFHREVAYMNNK
WAAYYTAGDPYINENFDMTEPYNRYYRLPHFG

Enzyme Prediction     

No EC number prediction in MGYG000001167_01333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	537	660	2.5e-21	0.711764705882353
GT2	281	390	2.3e-19	0.6352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.67e-79	279	479	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.64e-39	538	754	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.81e-25	532	793	1	255	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.66e-20	537	666	1	127	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	3.63e-18	281	438	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53720.1	3.27e-303	5	808	18	823
AZH69456.1	9.30e-303	5	808	18	823
ACV56016.1	1.32e-282	44	808	28	794
QOY61387.1	1.57e-282	11	808	9	809
ACV56006.1	1.14e-195	74	795	103	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.24e-06	281	404	8	127	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.03e-120	281	795	369	887	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.33e-98	252	799	293	834	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4UM29	9.24e-13	281	739	17	493	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
P71057	9.61e-12	281	491	7	225	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q57287	4.69e-09	281	518	8	257	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001167_01333.