CAZyme Information: MGYG000001166_01490

Basic Information

• Species: F23-B02 sp004557075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp004557075
• CAZyme ID: MGYG000001166_01490
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582		65922.57	7.4594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001166	2264247	MAG	Austria	Europe

• Gene Location: Start: 2196; End: 3944 Strand: +

Full Sequence      

MRLTYIFPVLMLLFIILFFIGCPPPAHADLRKNPHGSFTRRDALALGVIVILYSAVAFYN
LGDTKAPQSFHHFKSGESVVLDLGDEMQVDEMLFYSGLNTGSYKLEYSPDGQNFSAVGEF
KQSYTALFKWEKPELYDGAEATARYIRLSADSDMYLGELSVRSGGKNVEYTCAATGLCDE
QDIVPAHQTYLNSTYFDEIYHARTAFEHIEGVYPYEISHPPLGKLIIAAGIKLFGMTPFG
WRFSGTLFGSLMLPVLYIFLKRMFGGVAVPSSGTAIFAFDFMHFTQTRIATIDTYAVFFI
LLMYLFMYLYISGGRLRYLALSGIFFGIGAACKWTCLYAGAGLAVIWLIYWVRNFRLSAF
IKNCLFCLAFFVIIPSAIYYVSYYPYAQASGLHGIGAFFSREYADIVINNQEFMFSYHSG
VHSEHPYSSRWYQWLIDERPILYYLQSYSDGTRSSFGAFLNPVLCWAGLAAIFICAYLAL
FRQDKTSAFIVIGYLAQLLPWVFITRTTFEYHYFPASVFLVLAICRIFSLMQRGTMHWRF
NVYGLAGLSCALFVLFYPALSGKAVDSALASALLKWLPSWPF

Enzyme Prediction     

No EC number prediction in MGYG000001166_01490.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	191	386	1.4e-50	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	8.10e-20	414	558	10	179	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	4.59e-17	189	411	43	293	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	1.81e-15	215	489	132	368	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	1.03e-14	218	379	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.11e-13	190	385	17	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	4.76e-159	40	582	63	653
QQR07704.1	4.76e-159	40	582	63	653
QIA32159.1	1.51e-156	40	582	59	649
ALP95330.1	8.50e-156	40	582	74	752
QBB67038.1	1.69e-155	40	582	74	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	2.84e-16	217	580	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.84e-16	217	580	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.59e-14	217	580	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
L8F4Z2	4.51e-14	196	580	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.138445	0.646240	0.208354	0.002828	0.001376	0.002734

TMHMM  Annotations     

start	end
5	27
42	61
238	260
264	281
294	311
321	352
365	387
458	480
487	509
513	530
542	561