CAZyme Information: MGYG000001162_00029

Basic Information

• Species: UBA1822 sp900545365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp900545365
• CAZyme ID: MGYG000001162_00029
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000001162_2|CGC1	56367.24	9.4196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001162	1612933	MAG	Austria	Europe

• Gene Location: Start: 40386; End: 41903 Strand: -

Full Sequence      

MNRDRIYLLLYSLILFLIFLWNVPLLDPDEPVYGETAKEMIAAGDWLSPRIYGDFWYDKP
PLFYWLEAVSFSLLGVSTFSARLPSALIAAGTVLYVYGAAERLFSRRIAFTGAFILASSL
EFIVIARAAVTDMTLTAALTAALFSFLEKRYAAAYIACGFALLAKGPIGFGFPAFIVGLW
LLAQKRFTWKPIMALRWYWGIPLACLVGLPWYAYMVSVHGQPFVDTFLGYHNLVRFTQPE
HAGKDHWWLYFVVLTAGFFPWTGALAGALTRVRRFAADPKTLYLMVWAGFIFLFFSASST
QLFSYILPIFPPLAVLSAVYLDDLAQEGAGRLFPQLHIFFLGITAAAVAAAPLTPAGGLP
AKYGTALVMMILGLLAVRLFRGRNMRGFLFAQGALALFLTCAAWTLFAEPVREQFTSPHL
SMRAAVTERPEGTALWIDPFYRPASAFYHDLYGRPMPDLTKPGASIPGPADLLVQKKVVR
DWSPAVRDEWQTVWQTDTALLLRKS

Enzyme Prediction     

No EC number prediction in MGYG000001162_00029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	434	1.9e-110	0.8351851851851851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.96e-46	19	336	24	351	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	6.27e-34	28	333	31	345	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	3.69e-13	31	214	43	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	4.94e-13	58	187	1	138	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	1.75e-178	3	504	5	527
AOH39317.1	5.17e-166	2	504	6	527
ALG41392.1	2.61e-104	2	454	8	461
AVO73979.1	2.06e-103	2	454	8	461
CCC72524.1	2.06e-103	2	454	8	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.78e-32	25	384	54	434	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY4	1.54e-34	10	333	10	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	7.23e-34	10	333	10	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q6D2F3	9.25e-33	6	350	16	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C5BDQ8	1.21e-32	27	332	29	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
C6DAW3	2.32e-32	3	350	9	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26
78	100
109	131
151	182
195	217
247	269
281	298
302	321
334	353
363	380
387	406