CAZyme Information: MGYG000001162_00028

Basic Information

• Species: UBA1822 sp900545365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp900545365
• CAZyme ID: MGYG000001162_00028
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000001162_2|CGC1	59556.53	7.0482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001162	1612933	MAG	Austria	Europe

• Gene Location: Start: 38763; End: 40352 Strand: -

Full Sequence      

MLRTHRFSVLLTLYFFGSLILFLWGVQQMPVTDPVESLYALTAKEMVLSGDWISPQVFGS
FWYDKPPFMYWLLSASYSVFGFSNFASRLPAAFCGALSVSFMAWYVRRILNDETAAVWAA
AFLATALEFWVISHAVITDSALFLFAIPTFFSGYIGVKEKSWKHITIAWAAAALACLTKG
PVGLVLPGAILFLWCLSIRSFGGLARLFFPAGILVFLLIAGPWYYTMYDIHGQAFIDQFF
GLHNVTRALSSEHPEDNYFFYYLVLLPVALLPWTGLSFYTMAKKWKEKTDLYKFLMIACW
GTVLFYTLVATKYVTYTYIAVAPAVFLAVLALDDFRQEENKPAHAALVIPFVLTLAALVA
GSLYIDGNFLSLYVIVMYSGFLIFTQWKKKQFPSMLILSSATMAVAYMCAVFGGLAAWVG
TRSALDMTDALHSLPGEHYFFKSYPASYTYHTGEVGIRVYDAGMQKRDAVWETKQPLPTI
TTDELLAKTGDSVLYVGRREADDFAAWPGHERFEEVQAFPSGTIYRMEK

Enzyme Prediction     

No EC number prediction in MGYG000001162_00028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	410	1e-85	0.7314814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.82e-36	1	387	3	392	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	5.89e-19	34	360	31	362	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.01e-10	64	225	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.19e-04	36	224	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	1.26e-177	23	527	41	550
AOH39318.1	5.82e-152	10	526	11	535
AXB83023.1	1.31e-126	18	488	14	494
AXL21032.1	3.64e-116	23	525	19	534
ALG41393.1	1.31e-106	11	488	7	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.13e-25	18	276	41	302	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.08e-26	19	364	13	351	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B2VBI7	2.39e-25	2	327	1	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
Q1CIH9	3.47e-23	8	333	9	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
Q1C744	3.47e-23	8	333	9	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnT PE=3 SV=1
A4TIM6	3.47e-23	8	333	9	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26
68	87
89	106
116	133
140	157
167	196
203	225
258	280
300	322
342	364
369	387
397	419