CAZyme Information: MGYG000001157_00462

Basic Information

• Species: Gemmiger sp900540775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900540775
• CAZyme ID: MGYG000001157_00462
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41359.15	4.6909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001157	2792015	MAG	Austria	Europe

• Gene Location: Start: 3742; End: 4830 Strand: +

Full Sequence      

MQKADIENKLELCIESFKSVLYEKDETFLENMAKSNMDQGNLARYMLWEWTQGVGLYGLW
KLFEKKHDQRCLDVLTEYYDARIAEGLPSKNINTMAPIFALSYLYEYTKNEKYGDICKEW
AEWAMHGLPRAGEGGFQHVTSDRVNEGELWDDTLFMTVLPLANIGRILGRQDYIDEAVYQ
YLVHTKYLADKKTGLWYHGFCFDGCHNFAEAFWGRGNSWVTAAIPLLLEIVPVGNPDRRI
LENALLRQIESLAKYQDEGGMWHTLIDDPTSYLEASATSGFGFGILKAVEQGIVPESYRA
NAMRALQPVLDCIDEKGVVQQVSYGTPMGRESKDFYKQIPLHPMPYGQAMAILFLMEAEA
QV

Enzyme Prediction     

No EC number prediction in MGYG000001157_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	359	2.3e-105	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.70e-115	48	358	34	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.88e-101	48	359	27	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96760.1	2.05e-157	6	359	9	362
SET92327.1	6.48e-157	6	359	4	357
QEH70918.1	3.13e-156	1	357	1	357
AEC02491.1	3.28e-154	6	358	9	363
QQR00386.1	7.64e-153	4	359	6	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.74e-106	48	357	65	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.02e-105	48	357	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.25e-91	48	357	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	2.21e-24	48	311	23	300	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.41e-13	142	336	192	388	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.28e-58	48	355	29	332	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	8.97e-14	150	324	201	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001157_00462.