CAZyme Information: MGYG000001151_00442

Basic Information

• Species: Ruminococcus_C sp000433635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000433635
• CAZyme ID: MGYG000001151_00442
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000001151_56|CGC1	36542.08	4.8092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001151	2508735	MAG	China	Asia

• Gene Location: Start: 22031; End: 22990 Strand: +

Full Sequence      

MYTTPVNPNATPEATALLQYLHDIAGTNILAGQHTQTNPMEEVAYIETVTGKSPKLCGFE
LLAYSPNIRMEDASEACRIEVEENRNTMDTALRWANETGGIVTLTFHWFSPLGGHDKSFY
TEHTNFDAEQVLHDGTPERAAFFHDLDAIAVQLQRFQDAKIPVLWRPFHEAEGTWFWWGA
KGAEVAKQLYLLMYEYYVHHYHFDHLLWVWNSRLPEGYPGDDFVDVVSVDVYLPHYEATD
YAADYQALIAASSANKVAALAEIGFLPDAELLEKSKIPWAYFMTWSKEFCMGETYNTKQR
LKDVYNHERVLSQKPVLTK

Enzyme Prediction     

No EC number prediction in MGYG000001151_00442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	6	312	4.2e-98	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.01e-52	6	315	1	311	Glycosyl hydrolase family 26.
COG4124	ManB2	3.84e-09	161	210	180	229	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.48e-143	4	308	7	329
CBK82137.1	6.01e-138	7	314	6	313
AEB13973.1	2.27e-132	7	305	6	302
QUL56288.1	3.14e-121	1	307	5	311
AOZ93051.1	4.46e-121	3	312	7	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	6.54e-65	7	312	147	443	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	4.92e-63	3	316	4	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6Q75_A	8.26e-45	5	313	23	324	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.11e-42	3	302	32	335	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.02e-31	10	285	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.54e-66	7	312	176	472	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	3.07e-59	3	310	26	344	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.20e-55	10	313	151	454	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.64e-49	6	312	29	329	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.96e-39	4	312	156	456	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001151_00442.