CAZyme Information: MGYG000001095_01871

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_01871
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000001095_318|CGC1	38043.87	9.0933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 5551; End: 6573 Strand: +

Full Sequence      

MKASFFLKNLNSFFAFLIVLLSFLSFKANDKTIVVSKDGKGNFSTIQQAINAAENGSSVR
TKIVVKEGIYKEKIIIPETKGAILLEGENPEKTIITYDDFASKKNLEGKEFGTTGSSTVF
IYSNDFTAKNISFENSSGKVGQAVAVLTTGDRIAFENCRFLGNQDTLYLKGVQDSSDKTK
PSRNYFKNCYIEGTTDYIFGAGTAVFEECIIYSKESASYVTAASTPQENEFGFVFINSKI
EGNAKENSVYLGRPWRPFAKTVYLNCEMNSTIQPEGWHNWNKPDAEKTTFYAEFNSKGSG
SDRSKRVSWSHQLAKTEAKKYTREQVLKGKDNWNPLINLK

Enzyme Prediction     

No EC number prediction in MGYG000001095_01871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	33	328	6.3e-105	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.25e-91	30	321	4	290	pectinesterase
pfam01095	Pectinesterase	4.96e-88	33	329	2	297	Pectinesterase.
PLN02682	PLN02682	1.50e-83	1	322	53	356	pectinesterase family protein
PLN02432	PLN02432	6.73e-78	33	331	13	290	putative pectinesterase
COG4677	PemB	7.70e-75	33	329	83	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD0219675.1	7.21e-207	1	340	1	340
QXU49712.1	2.41e-205	1	340	1	340
ANF49931.1	2.30e-203	1	340	1	340
AZA53401.1	9.35e-203	1	340	1	340
ALR30071.1	7.66e-202	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.36e-45	33	309	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.35e-41	34	309	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	9.69e-38	41	306	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	9.69e-38	41	306	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.80e-37	36	337	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.90e-67	28	318	2	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	2.40e-58	34	321	87	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O23038	4.74e-57	33	333	91	387	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q9FM79	1.88e-56	31	333	80	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LXD9	7.59e-55	33	313	241	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.148113	0.656594	0.193961	0.000380	0.000340	0.000576

TMHMM  Annotations     

start	end
5	24