CAZyme Information: MGYG000001095_01609

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_01609
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		62057.26	9.3839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 1919; End: 3610 Strand: -

Full Sequence      

MKKLIYSSLFIFIFSSSKLSAQYQPKNISKDDLKKANQWVDKTYKSLSQDEKLGQLFIVA
LYTNRGENEIEKVRSIVTNDKIGGLILMQDDAAREITLVNEFQQKSKVPLMIGMDAEWGL
YQRIAAAHKFPWAMTLGAIQDKSLIEKMSAKIAEDCHRMGINWDFAPVVDVNTNPNNPII
GNRSFGSEVSNVVNSASAYANGLQNNSILAAIKHFPGHGDTSTDSHTDLPVVAHNLERLN
NVELAPFKTLMNKGIGGVMVAHLYVPALEPNKGIPASVSKNIITGILKNKFGYKGLIITD
ALNMGAVANKYKPGELDAMAFKAGNDIMLFSQGVTEGKKLIQKAIESGEISQSRVEESVK
KILLTKYFLGLDKYTPKNPENINSDLNNDSHKTLVQNLYSNALTLLKDEKKLLPLTGKQI
YYVPLEEAPYQTFANRLGSNIIIKKADEIATIPANSTVIVGFHKDNSTAYKPYKISDASK
KVLSDLTKNQNVILNVFGSAYALKDIDISKISTVLVSYENNEDSMNATADALNGKTKIWG
RLPVLVNDTLKAGMGMDLNDSQK

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	103	329	8.8e-60	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.72e-84	50	363	3	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	1.59e-79	47	418	1	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	4.88e-32	82	329	26	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.29e-27	1	415	1	407	beta-glucosidase BglX.
PLN03080	PLN03080	3.01e-07	246	430	249	434	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWA37586.1	0.0	1	558	1	558
AYZ10482.1	0.0	1	561	1	561
AZB01323.1	0.0	1	559	1	559
QUY55837.1	0.0	1	561	1	561
AZB24612.1	0.0	1	559	1	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.41e-66	45	550	9	535	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.02e-65	36	431	35	462	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.41e-65	36	431	9	436	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.16e-64	36	431	39	466	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	2.54e-60	82	366	58	346	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.10e-64	36	431	35	462	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	6.10e-48	72	547	54	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	1.23e-46	39	419	18	402	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
L7N6B0	6.60e-36	47	366	59	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	6.60e-36	47	366	59	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000918	0.998122	0.000363	0.000205	0.000187	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_01609.