CAZyme Information: MGYG000001081_02213

Basic Information

• Species: Acutalibacter sp900755895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp900755895
• CAZyme ID: MGYG000001081_02213
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	MGYG000001081_160|CGC1	73231.81	6.3445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001081	3715652	MAG	Sweden	Europe

• Gene Location: Start: 58577; End: 60541 Strand: -

Full Sequence      

MKQLSPRQIHLDFHTSENIPGIGSTFDPEAFAKTAKEASISSMTVFARGHHGWLYYPSKK
FPELVHPHLEYKNLLVDQVRALHKVGINAPVYITVQWDYHSATTHPEWLIRKKDGSHEGG
PFTEPGFYQSLCVNTGYWDFLKAQTIEVCELLGDELDGLFFDIVGIRPCWCAACRAEMKK
LGIDASDDEAVRDFAKMVLDRFKKNMTELVRQYNQNCTIFYNAGHVGPCTKDSADSYTHF
ELESLPSGSWGYLHFPLTARYARKLGKDCMGMTGKFHTEWGDFHSLKNLAALEFECFRML
SFGFASSIGDQLEPNGTLNPATYRLIGKVYSQFAEREAWARPSTPVVEAAVVTPESPRVE
HQIPESVMGAVQMLEELAIQFDVIDPGMSMDAYKLVILPDDLVVCGGFQKKLEDFVAKGG
KVIACAKGGQNQEGKYPSCFGAKSAGPQNVYPDFLIAEGKLAEGLEPENEYVIYMQGEAL
EPAGAEIILSARAPYFKREKDFFCSHRYTPSAKGEAYPAVLQKGGVILFGHPIFQQYRKN
APFWCKKLISNAIDMLLGERLVRHDGPSTMTVSVLDQPEEARTNLHILSYVPVRKSATID
IIEERTVLRNVTVKVNIPRKFTQARLVPEDIPLEVKDGSVTIPEINGYAIVELK

Enzyme Prediction     

No EC number prediction in MGYG000001081_02213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	27	163	9.3e-43	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	1.05e-38	27	163	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd03143	A4_beta-galactosidase_middle_domain	5.37e-09	374	424	35	85	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG1874	GanA	3.31e-08	9	424	4	489	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	2.90e-06	376	444	41	119	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97446.1	4.11e-225	7	654	9	662
QEY34430.1	2.03e-195	1	654	1	664
QDU70523.1	6.39e-192	3	653	2	668
QGH36620.1	5.28e-189	1	615	1	615
QRT30085.1	6.00e-188	1	651	1	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVK_AAA	1.20e-121	7	651	33	683	ChainAAA, Alpha-L-fucosidase [Paenibacillus thiaminolyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001081_02213.