CAZyme Information: MGYG000001079_00277

Basic Information

• Species: Campylobacter_B sp900539505
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B sp900539505
• CAZyme ID: MGYG000001079_00277
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22346.9	6.8499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001079	1324289	MAG	Sweden	Europe

• Gene Location: Start: 57; End: 659 Strand: +

Full Sequence      

MGHPLLDEITLRKQSYEKQGKIAFMPGSRRAEISRLMPIFRALAPKFENSERALIIPPHL
MDQRDEIYGPLDGFSIANDTPATLKDCDFAFVCSGTATLEAALIGTPFVLCYKARAFDVW
LARKLVKLKHVGLANIIFDFLGEEPLHEELLQGEVSTQNLLAAYERCDAAKFKLASEKLR
DYLKFGSSENVAKILTQPAS

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	171	9.4e-45	0.5028248587570622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	4.51e-108	2	198	150	347	lipid-A-disaccharide synthase.
COG0763	LpxB	2.10e-41	2	197	162	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.53e-32	2	189	159	365	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK00025	lpxB	2.15e-31	2	194	160	370	lipid-A-disaccharide synthase; Reviewed
PRK01021	lpxB	8.55e-08	1	137	386	541	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT91885.1	3.66e-131	1	200	196	395
QPI05286.1	4.43e-81	1	195	147	340
QPH86756.1	6.28e-81	1	195	147	340
QPH98091.1	8.90e-81	1	195	147	340
QPI01654.1	1.26e-80	1	195	147	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.22e-12	22	163	194	340	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.22e-12	22	163	194	340	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	8.60e-62	1	197	160	363	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	8.60e-62	1	197	160	363	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	3.42e-61	1	197	160	363	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
B5Z7M7	1.04e-45	1	192	147	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
O25537	8.10e-45	1	192	147	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001079_00277.