CAZyme Information: MGYG000001070_00399

Basic Information

• Species: F0422 sp900544365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp900544365
• CAZyme ID: MGYG000001070_00399
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		61608.42	8.6348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001070	1755005	MAG	Sweden	Europe

• Gene Location: Start: 4855; End: 6462 Strand: +

Full Sequence      

MEQTFSWKRFAWLGIGTFLFYLFMAWALPVTDTVESNYALSAVTMMKHGEFLSPMIYDMY
WYDKPIMAYWGLILSYSLFGISDLAARLPSIVVSTCTVLAMYRMAFSIYQVERVAMWSAI
ALGTALEFWYIGHAVVTDGYLFLFSMGIFYYVYRGITGESHRHMIYAYIFAGLAVLTKGP
VGIVLPGIILILYVALNRHMDWFKYIFSWKGILAFILVIAPWYGYMYYVHGDAFIQEFLG
LHNVTRATVPEHPEHNWWYLYFALLPVCMMPWTSFVVRGINEQKHAYIWYWSIFWFVGTV
LFYTCVATKYVTYTFIMLIPLALWAGMGIHACIEEYKGRKMTWKVFTLYALGGAPFLLGL
DIAGLSISLTHGAYLWISLAVTVLSCIYAANKRTGYVLVCSMATSAVVFYLALVPNLVPV
MEDQSGKVLANKVMALEGATPLDVYQYGNYRTSLSYYLGRTTSYIHYKEHESVWENGKNI
MPMIKPTELAKDKEKLSRALIYVPNKYATYFKETSLYDHVQPVERDSRGVFYRVK

Enzyme Prediction     

No EC number prediction in MGYG000001070_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	497	4.6e-83	0.9462962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.36e-36	1	383	1	397	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.59e-17	63	222	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	5.02e-12	35	339	33	343	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	3.34e-06	26	230	23	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU36964.1	1.03e-104	9	535	8	538
SNV73216.1	4.08e-104	9	535	8	538
VEG94157.1	2.27e-103	9	535	8	538
QQB17174.1	3.69e-103	19	520	16	522
SNV02078.1	3.69e-103	19	520	16	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.33e-09	35	274	59	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	7.66e-18	13	248	8	228	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	6.85e-17	8	295	3	272	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q02R27	1.04e-15	35	352	32	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
B7VBN0	1.37e-15	35	352	32	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	1.82e-15	35	352	32	352	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31
59	81
88	110
114	133
140	157
172	194
207	229
258	280
287	306
311	333
345	367
372	389
396	418