CAZyme Information: MGYG000001055_02017

Basic Information

• Species: CAG-484 sp000431315
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484; CAG-484 sp000431315
• CAZyme ID: MGYG000001055_02017
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42135.35	9.4082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001055	2019920	MAG	Spain	Europe

• Gene Location: Start: 23955; End: 25079 Strand: +

Full Sequence      

MKKLFVITGEYSGDIHASKVVAALKSKYSELVVEGIGGENLKSAGVKLFSDQKKMGAVGL
SPKIVIDHFTLGKRVVDYITKEFKPDLVLLIDYGVFNLNVSKFLKKAGIKVFYYIPPQVW
ASRKWRINTIKKNVDEVLCIFPFEKEMYESYGIKTHYCGHPLVSQLPAKADRKEFFERHG
FDLNKKLVSVFPGSRVFELKQLMGVFIRTAKDLQQKHPDLQFCISHAPNLPDDVYNKYLK
DTDFKVIKGENQALLSVSDALILASGTVALEAALYQTPMIIAYRGPWLFYFIYLLVRCIK
MVSLPNIICGKTIVPEILQGDVTVRNISYNIEKLLYDNAYRAENIAGLQGVKDLLSDKVS
SAEAAEEIAKTLSL

Enzyme Prediction     

No EC number prediction in MGYG000001055_02017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	353	4e-105	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.29e-114	1	372	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.51e-102	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.24e-75	4	344	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.11e-69	6	327	10	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.50e-49	1	327	1	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.71e-219	1	372	1	372
ABG58662.1	3.93e-75	3	372	2	367
QMU61387.1	1.96e-74	4	365	13	377
VEH12442.1	1.25e-72	2	372	5	379
AEG01383.1	4.30e-72	9	366	15	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.90e-45	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.90e-45	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	5.47e-71	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	8.03e-68	3	366	11	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q5ZVR9	2.13e-67	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5WWX7	2.34e-66	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
B8JE78	8.97e-66	3	368	10	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001055_02017.