CAZyme Information: MGYG000001045_02621

Basic Information

• Species: Enterocloster sp005845215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp005845215
• CAZyme ID: MGYG000001045_02621
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		64318.56	9.9633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001045	5511723	MAG	Denmark	Europe

• Gene Location: Start: 15; End: 1697 Strand: +

Full Sequence      

MKKLEDGTWAKRTAGEMDGSFRIGFIQTPQSFYNPDLFQFNFFSEKRIPNEQDFFFKEVN
VGRNKANAPIYAGSNTLLSRQALNEAGGFATGTVTEDFETGLRIQSKGYTCYAIDKILAH
GLAATDVGSLVRQRIRWGRGCIHSLRRVHILWNPGFKFNTKCSYLSCLMYWWTFLRRFVY
ISAPILAVLSGVPVVVCSLEGFLFIWLPAYLLYNQALKVVSGRIRSRRWSNIIDTTMFPY
LIVPIVLETLYFKQRTFHVTDKRRVRGRNSSWKLAIPHMLFLLFDLAALFLCLRHVFLNG
FFGSVILAFWLAANGLDLVMAVFFMTGRKNLRTNDRFDVQMPAEITYLGRESHGVTENIS
ETGLSVITKEPVYVPYEKEQAVVHLKSRKYEAWIKCRAVHVRRVGNGWLYGLQIMSLEGE
NKKQYYQMLYDRHHGLAEQIHKSAGLYRDIWLNIRKRFRGNTVSGQKLPGISLDVELETL
EMGRVRAVAWDFESITLEGTGGKERLTLVAPEQGMMVRCVLAGPERGRYRIENQRELLLS
ESFGGLFCRDASRDIAMEGR

Enzyme Prediction     

No EC number prediction in MGYG000001045_02621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	17	198	9.7e-21	0.8223350253807107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	5.50e-42	8	145	100	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	6.49e-28	22	345	369	696	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	1.37e-21	9	279	154	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.28e-20	9	147	101	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13632	Glyco_trans_2_3	6.99e-19	22	189	27	187	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL34255.1	3.01e-159	1	549	191	747
QJA08945.1	5.69e-147	1	543	194	733
AEF82376.1	1.68e-140	1	473	210	683
ALU14736.1	3.18e-133	23	459	195	629
QCT70363.1	3.28e-132	23	459	204	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.59e-32	12	371	246	610	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.89e-32	12	371	258	622	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.90e-32	12	371	259	623	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.85e-32	22	366	382	731	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	2.90e-36	22	370	268	621	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9WX61	1.77e-35	15	384	251	627	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q9WX75	8.98e-33	11	369	244	609	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	8.98e-33	11	369	244	609	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
P37653	1.54e-31	22	366	382	731	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
178	212
232	254
275	297
302	324