CAZyme Information: MGYG000001040_01467

Basic Information

• Species: Prevotella sp900554045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554045
• CAZyme ID: MGYG000001040_01467
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		62449.44	5.7356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001040	2860396	MAG	Denmark	Europe

• Gene Location: Start: 66; End: 1781 Strand: +

Full Sequence      

MNFGTGSDIDAQFSRLRELRPQSPLMCSEFWSGWFDKWGARHETRPADAMVDGIDEMLSK
GISFSLYMTHGGTSFGHWAGANSPGFAPDVTSYDYDAPINEYGLPTEKYYKLREVMQKYA
DGKLPAVPKPAAGIIDVPELALTEYAPLACGIDSTATSSRPLTFEDMDMGWGTMVYTTAL
PEVPVQSVLYFDGAHDFAQVFIDGKYVGKTDRVRNETAVAMPPLKKGSLMTVVVEGMGRI
NFGRAIKDFKGLTGDVTLRATVDGDEVTWNLRDWTMQTVPDGYADAVRALAVKPLPTSPI
GRSRNAKVTNNSTISNLITSPIGGGREGAGYYRGYFNLKKTGDTFLNMETWGKGQVYVNG
HAVGRFWSIGPQQTLYVPGCWLKKGKNEVIVLDVVGPREAKLWGQSKPELDKLQLEKSNL
HNNPGDRPDLNSATPAATGEFTAAREWQKITFTSAAKGRYIAVECLGSQDGGDVVSMAEF
YVTDAQGKRIDRNQWAVKYADSEDAAGGNHTGDKAFDLQESTYWSTVGGTKAPHLLVIDM
GKVQTVGGVEYLPCTTETSVSGIKGYKIYVY

Enzyme Prediction     

No EC number prediction in MGYG000001040_01467.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.54e-49	1	116	202	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	9.99e-18	24	396	250	715	beta-galactosidase; Provisional
pfam00754	F5_F8_type_C	5.09e-06	500	570	2	70	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG1874	GanA	6.47e-05	23	397	237	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam13364	BetaGal_dom4_5	9.75e-05	305	392	11	104	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84536.1	4.36e-256	1	571	233	779
VEH15027.1	1.94e-253	1	571	233	784
QVJ81893.1	4.97e-252	1	571	227	787
ADE83089.1	3.75e-249	1	571	227	787
AGB27610.1	4.48e-240	1	571	246	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	2.36e-166	1	570	231	772	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	3.85e-124	1	426	211	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	4.43e-75	1	394	221	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	1.47e-60	1	394	217	598	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.16e-60	1	394	241	622	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16278	1.16e-59	1	394	240	621	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q95LV1	5.65e-59	1	426	236	641	Beta-galactosidase-1-like protein OS=Macaca fascicularis OX=9541 GN=GLB1L PE=2 SV=1
Q6UWU2	3.96e-58	1	426	236	641	Beta-galactosidase-1-like protein OS=Homo sapiens OX=9606 GN=GLB1L PE=2 SV=1
Q5R7P4	4.11e-58	1	378	240	604	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q58D55	5.39e-58	1	394	239	620	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999877	0.000169	0.000002	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001040_01467.