CAZyme Information: MGYG000001040_00908

Basic Information

• Species: Prevotella sp900554045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554045
• CAZyme ID: MGYG000001040_00908
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		48515.4	8.8495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001040	2860396	MAG	Denmark	Europe

• Gene Location: Start: 11252; End: 12538 Strand: +

Full Sequence      

MCRVENESFIFTNIKMILEQVFTRLFQYMLIIASILAVSSCSDGKKEKIVTPWGEVGVDS
VPKNLNFTVDDIISNGELIILTLSGPETYYDYRGRGMGTQYLLCEKFAEKLGVSLRVEVC
KDTAEMVSRLENGDADLIAVPLPKKQNAGKGLLFCGAGVDSLGIQWAVADGNKELADSLD
AWFKPSMYDDIKREERYMFSAQSIKRHVYSPFLNRQSGVISHYDHLFKRYAPLARWDWRL
MAAQCYQESCFDPKARSWAGACGLMQIMPATADHLGLPRSSIYDPEHNVRAAAEYLRELS
GYFRSVQNQAERQLFVLAAYNGGYFHVQDAMALARKNGRNPHRWKDVAYYILALEKPEFY
NDQVVRHGYMRGSETVGYVDGIRQRYAQYRGVPYGGASVKGWDGKQGAGGSFSPFTPRKA
KRKHRFHI

Enzyme Prediction     

No EC number prediction in MGYG000001040_00908.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	236	388	5.9e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	9.67e-76	227	390	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	4.13e-53	68	386	35	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.09e-49	70	391	17	433	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	2.80e-24	222	323	5	107	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	4.56e-24	237	342	11	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	3.85e-176	40	428	17	391
VEH15587.1	2.61e-172	39	428	46	433
BCS86517.1	2.39e-167	38	428	7	390
AGB28026.1	9.49e-163	39	428	39	413
QUB48180.1	1.50e-161	38	428	16	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.81e-26	69	386	4	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.95e-26	69	386	11	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	3.13e-26	76	386	4	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.13e-26	76	386	4	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	3.43e-26	69	386	45	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	2.76e-33	69	386	40	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A8AD27	1.08e-31	72	384	39	446	Membrane-bound lytic murein transglycosylase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltF PE=3 SV=1
A4WDC7	1.10e-31	72	384	39	446	Membrane-bound lytic murein transglycosylase F OS=Enterobacter sp. (strain 638) OX=399742 GN=mltF PE=3 SV=1
A4SNZ5	1.21e-31	69	386	40	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
Q31XS9	8.68e-30	72	384	39	446	Membrane-bound lytic murein transglycosylase F OS=Shigella boydii serotype 4 (strain Sb227) OX=300268 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.025424	0.225033	0.748763	0.000125	0.000449	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001040_00908.