logo
sublogo
You are browsing environment: HUMAN GUT
help

CAZyme Information: MGYG000001021_00657

You are here: Home > Sequence: MGYG000001021_00657

Basic Information | Genomic context | Full Sequence | Enzyme annotations |  CAZy signature domains |  CDD domains | CAZyme hits | PDB hits | Swiss-Prot hits | SignalP and Lipop annotations | TMHMM annotations

Basic Information help

Species Ruminococcus_C sp000980705
Lineage Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
CAZyme ID MGYG000001021_00657
CAZy Family GH73
CAZyme Description hypothetical protein
CAZyme Property
Protein Length CGC Molecular Weight Isoelectric Point
401 43343.11 4.6019
Genome Property
Genome Assembly ID Genome Size Genome Type Country Continent
MGYG000001021 2360136 MAG Sweden Europe
Gene Location Start: 107245;  End: 108450  Strand: -

Full Sequence      Download help

Enzyme Prediction      help

No EC number prediction in MGYG000001021_00657.

CAZyme Signature Domains help

Family Start End Evalue family coverage
GH73 266 397 6.7e-19 0.96875

CDD Domains      download full data without filtering help

Cdd ID Domain E-Value qStart qEnd sStart sEnd Domain Description
NF033838 PspC_subgroup_1 1.56e-13 35 235 472 670
pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263 COG5263 3.58e-13 41 229 148 311
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
COG5263 COG5263 6.18e-13 85 240 151 304
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
TIGR04035 glucan_65_rpt 4.58e-12 57 106 2 52
glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
NF033840 PspC_relate_1 4.89e-12 83 235 507 634
PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits      help

Hit ID E-Value Query Start Query End Hit Start Hit End
AFC63685.1 6.54e-77 235 398 203 366
QUO23193.1 3.64e-76 238 395 1 158
QJU16443.1 6.12e-76 237 401 5 169
QMW80642.1 1.53e-72 237 401 5 169
QMW80001.1 2.70e-72 235 399 173 337

PDB Hits      help

has no PDB hit.

Swiss-Prot Hits      download full data without filtering help

Hit ID E-Value Query Start Query End Hit Start Hit End Description
O51481 7.71e-24 239 400 45 197
Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations help

This protein is predicted as SP

Other SP_Sec_SPI LIPO_Sec_SPII TAT_Tat_SPI TATLIP_Sec_SPII PILIN_Sec_SPIII
0.001156 0.545120 0.451907 0.001279 0.000313 0.000211

TMHMM  Annotations      help

There is no transmembrane helices in MGYG000001021_00657.