Species | Ruminococcus_C sp000980705 | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Lineage | Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705 | |||||||||||
CAZyme ID | MGYG000001021_00657 | |||||||||||
CAZy Family | GH73 | |||||||||||
CAZyme Description | hypothetical protein | |||||||||||
CAZyme Property |
|
|||||||||||
Genome Property |
|
|||||||||||
Gene Location | Start: 107245; End: 108450 Strand: - |
Cdd ID | Domain | E-Value | qStart | qEnd | sStart | sEnd | Domain Description |
---|---|---|---|---|---|---|---|
NF033838 | PspC_subgroup_1 | 1.56e-13 | 35 | 235 | 472 | 670 | pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. |
COG5263 | COG5263 | 3.58e-13 | 41 | 229 | 148 | 311 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]. |
COG5263 | COG5263 | 6.18e-13 | 85 | 240 | 151 | 304 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]. |
TIGR04035 | glucan_65_rpt | 4.58e-12 | 57 | 106 | 2 | 52 | glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. |
NF033840 | PspC_relate_1 | 4.89e-12 | 83 | 235 | 507 | 634 | PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. |
Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End |
---|---|---|---|---|---|
AFC63685.1 | 6.54e-77 | 235 | 398 | 203 | 366 |
QUO23193.1 | 3.64e-76 | 238 | 395 | 1 | 158 |
QJU16443.1 | 6.12e-76 | 237 | 401 | 5 | 169 |
QMW80642.1 | 1.53e-72 | 237 | 401 | 5 | 169 |
QMW80001.1 | 2.70e-72 | 235 | 399 | 173 | 337 |
Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
---|---|---|---|---|---|---|
O51481 | 7.71e-24 | 239 | 400 | 45 | 197 | Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1 |
Other | SP_Sec_SPI | LIPO_Sec_SPII | TAT_Tat_SPI | TATLIP_Sec_SPII | PILIN_Sec_SPIII |
---|---|---|---|---|---|
0.001156 | 0.545120 | 0.451907 | 0.001279 | 0.000313 | 0.000211 |
Copyright 2022 © YIN LAB, UNL. All rights reserved. Designed by Jinfang Zheng and Boyang Hu. Maintained by Yanbin Yin.