CAZyme Information: MGYG000001017_01440

Basic Information

• Species: Lactococcus garvieae_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae_B
• CAZyme ID: MGYG000001017_01440
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24287.58	9.3658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001017	1758548	MAG	Bangladesh	Asia

• Gene Location: Start: 882; End: 1520 Strand: +

Full Sequence      

MTYDKKRRKSTSKIRSFFRIVLQLLIFLFVAANLLNFRIIQTSDNRNDTELANQVETITE
YNFIRTIAPYAQESQEKYHVLASLTLAQAALESNFGQSGLAAKYYNLFGIKAYGDVPTVT
LDTKEFENDKWITVKAKFRVYDGWKESVEGHAYLFTKGTTWNPKQYASVLAAKNYKEAAK
AVQTSGYATDPAYTEKLIQMIESYGLDQYDKI

Enzyme Prediction     

No EC number prediction in MGYG000001017_01440.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	68	206	1.5e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.48e-66	13	212	2	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	4.65e-40	62	210	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	4.24e-36	40	211	297	473	amidase domain-containing protein.
NF038016	sporang_Gsm	1.71e-32	63	210	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	6.46e-32	62	203	154	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAV02010.1	2.32e-146	1	212	1	212
QSR11788.1	2.16e-144	1	212	10	221
QSR05052.1	2.16e-144	1	212	10	221
BAK60757.1	4.36e-144	1	212	10	221
QSQ99693.1	4.36e-144	1	212	10	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.63e-27	45	210	15	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	3.37e-21	62	202	5	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.83e-21	62	202	5	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.62e-18	45	210	45	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.26e-15	63	208	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.05e-47	50	212	37	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	1.81e-25	40	210	45	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P58231	6.14e-21	63	202	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	6.14e-21	63	202	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
A2RHZ5	7.34e-21	54	210	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000007	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
20	42