CAZyme Information: MGYG000001017_01251

Basic Information

• Species: Lactococcus garvieae_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae_B
• CAZyme ID: MGYG000001017_01251
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		22576.66	6.722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001017	1758548	MAG	Bangladesh	Asia

• Gene Location: Start: 5695; End: 6306 Strand: +

Full Sequence      

MLKILKLFIKLALLAAVVGAGFYVHRTYKNVKNVMQYEKSVDATLKAQGLEGDTKLALAI
IYTETKGNAADVMQSSESLNGNQNSISDEDKSIEQGVSNLCKVLEYAEDKNVDIWTGVQA
YNFGQAYIDYVAKNGGKNNLELAEKYSRTVVAPSLGNTTSATYYHVTVDSLMNSRGKLYV
NGGNMYYADEVKWHLMLLNLFNW

Enzyme Prediction     

No EC number prediction in MGYG000001017_01251.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	5.09e-71	31	195	1	165	Lysozyme-like.
cd16891	CwlT-like	2.92e-67	37	196	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	2.10e-07	4	203	94	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAV03181.1	5.10e-141	1	203	1	203
QSR10393.1	8.12e-138	1	203	1	203
QSR04080.1	8.12e-138	1	203	1	203
QSR11968.1	8.12e-138	1	203	1	203
QSR01698.1	2.72e-136	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	5.25e-16	34	148	26	139	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.67e-14	34	195	24	177	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8P120	1.99e-56	13	200	12	195	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q5XC63	2.82e-56	13	200	12	195	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q99ZN9	8.03e-56	13	200	12	195	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
P0DC90	1.61e-55	13	200	12	195	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	1.61e-55	13	200	12	195	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.953337	0.039478	0.005760	0.000186	0.000108	0.001144

TMHMM  Annotations     

start	end
7	24