CAZyme Information: MGYG000001016_01596

Basic Information

• Species: UMGS1537 sp900543695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900543695
• CAZyme ID: MGYG000001016_01596
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1148	MGYG000001016_20|CGC2	127754.46	4.3202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001016	2558639	MAG	United Kingdom	Europe

• Gene Location: Start: 46303; End: 49749 Strand: -

Full Sequence      

MKKTGTWLRRLTACCLAGAACAVFLCAGCTRKNEKGDDTKIILPEELLPYRRITAMIKED
WTANWIWTQSGETEPDTWVSFRKSFEVSDINEARDAVACIAAESKYWLYINGEMAVREGG
LKRGPTPEDGYYDTVEIGQYLREGENTIAALVWFWRDGASYSSTNSGKGGFLFEAELGGE
KLISDASWLAARNTAFLQDPGARQPNYRLPEANIYYDARRELTGWEQPGYDDSGWEAAKE
MGTGGCAPWNALYERPIPLWKDFGLKDYKNSSEYENDTLTRGQELTMEVPYNAQLTPYLE
VESEAGKEIVITTENTAQGSVFATYITKEGRQSFESPGWMNGERITYRIPKGVKIISLKY
RESGYNTEFSGSFTCSDAFLNTLWMKSLRTLYITMRDNFMDCPDRERAQWWGDVTNEMAM
SMYALDTNSYLLYQKGVATMLAYTDPGTKVLQTVVPIRNDYFELPMQQLAGVCGFWTYYM
YTGDAEFIKEVYPYAKDYVGLWTLGSDGLVVHRGGSWDWADWGSDFDMPTLENAWYYKAL
QCVIDMARLTGNEGDIAELEQKAETVYAAYQTFWTEEGYKSASVRLPDDRSNAVAVLAGL
ADPDKYEGIRGNLTTVMHASPYMERYVLDALCEMGYMEDAQQRIRTRYKEMVEYDYSTLW
EFWDHGGTLNHAWSGGPLLTMSQYMAGIEPAEAGYTKFSVKPMLGDLTSLECTVPSVRGY
ITVNISSEPGKEFSLSLKAPANTEAIVGIPRLGPAGSNLQIKYHDAVIYENGADCVPEQM
SETLSFSGSDDQYLYYVLKNRAADAAHAFSAALADAQERSAYTVRLEVGANGAVFWNGER
LESGSHEKTVQNGEEFTLEAAAGDGAYFCGWSGAAGTREAVLSVRPQCDMTLRAEFSEKQ
NVLRTVTFSAEAECDVAILTDGGTEIALAQGTNKVFVKDGETVTFTARDGFLHRFASYQG
DVSSLDNQITVTADRDLEIRIETKKLDAENVALGAAVFAENSLENNDWSVSGLTDGSLKK
GYTTNVLQPDSDGRISPVSVTLDFGEEKAFSHIALAPRTEVSDANGGSPNYPTEFTVSVS
DDGRNFTEVVTIEDSENPMGVTQGYELGPQRAAYVRIDFTGTGTFAADEGVADPYRIQLM
EIYLYHVK

Enzyme Prediction     

No EC number prediction in MGYG000001016_01596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	300	747	6.4e-91	0.9186507936507936
CBM67	63	249	8.6e-43	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.70e-32	368	685	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.36e-15	92	240	2	152	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam00754	F5_F8_type_C	8.81e-10	1002	1124	6	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	1.03e-09	687	763	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17132	Glyco_hydro_106	3.98e-06	1013	1145	188	314	alpha-L-rhamnosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35844.1	1.15e-228	66	750	7	691
QEV28934.1	4.14e-227	48	1142	27	1117
AXE90460.1	2.61e-221	61	1142	40	1117
AZP23721.1	7.45e-220	48	1142	1	1091
QYX75380.1	2.23e-219	47	1142	26	1117

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.78e-30	56	799	140	943	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.73e-09	59	753	109	850	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	4.85e-06	63	252	138	295	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.05e-10	368	745	728	1132	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000021	1.000007	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001016_01596.