CAZyme Information: MGYG000001004_01002

Basic Information

• Species: CAG-56 sp900539525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900539525
• CAZyme ID: MGYG000001004_01002
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1356		146372.75	5.2474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001004	2903340	MAG	Austria	Europe

• Gene Location: Start: 94; End: 4164 Strand: -

Full Sequence      

MKLRKKCLSSVLSAAMVLSVFSVPANAEAADTKEARVADADLTDNNTAAPEAWGATPSPN
QYRYQKEELAAFCHFGPNTFNEVEWGENYGNRAPADIFTLQQDFDAATMVRTLKEAGFKK
LIVTAKHHDGFCIWASEFTTYDVASTNYKSGKGDVLAEISAACTEYNMDMGLYLSPWDIH
EPSYGYYDANGQATSKENDVLDYNEYYNNQLEEILGNSKYGNNGHFVEVWMDGAKGSGAN
AQDYDFQTWFHTIQKHEGKAAGYDDDCMLFGAQAYTTVRWIGNELGLAAEETWSKSRTDK
EANTIDSNKSGSYTKGFYDGNQWTVPEADARITSGWFWGNGKKTPKTIADLSNMYFNSVG
HNATLLLNIPPNNQGKVDQAILDRVTEFGQNIRDSFADNLAKDATISASAVRGNAKAFSP
AKVTDGDQDTYWTMDDGQTTGSLTLELGGIKTFDMVTIEEAIQLGQRISGFRVEYRQGNE
EWKEFASGTTIGAKRICRNKAVKADQVRISITSSYAVPLISEAGVYKATEGFEIASPIPD
DLRQVGVTDKNTDDGFGWTYTGWNAESGTQFISGNGIWAGSGKEATLTFTGTKVWLYGTK
DPGHGTADIYIDGTRVTSINTKSSPRATGQIIFESDTLQSGNHTLRIVNTGTIGIDTAAV
LDNGGAGMVQFDTKRLEMEENSVKKLLVRRVGGSTGEIRVTYENNPGSAVQGNYDVDGIK
GELVFADGETEKEIAVTTKRDIGYKGDLDFTVDLVSITGNGILGSSSVKVIIRDMDDAGR
IPEAEQLMEEVRTLVYDLYEREGQDEVKQLAAELEAYLGAKEIVRPADILRTASELKAAK
EALVPMSTGPAGDTYTSEDRFVMPVGGAVKMTEAEWFILDASGAADANKYVRLTERADAS
NGKEVNWFENGNRIRLPFTAAKAGTYKVKATYRSGRAAGSPNAFEWSGTNVTPGSKDVYG
ETNATTFHTAEFDVAVTAAGAGELVFTAGTKGGPVIDKFEIISTEQAETVLVTGVTLSKT
EAALTDENSYVFLKATVLPANATNKDVTFSSSDPSVAAVTDKGLVTAVPGAVNKTAVITV
TTADGAKTAECRIKVGFAAEEEKGIKLEELQAKLKEIDSVIAAGKGKYTDASWNALINAY
NSAKKANAETDADEIQTMLDGLKAAKEGLQIASGQPKPVPEQPGNTDQEIRQGQTYDSGN
FSYKVTSTSDLTAEVVALKNKKISAIRIYNTVILGGKSYKITSVASSVFKNNKKIRSVTV
GKNVKTIGSSAFAGCTSLTKVAINSKGLERIDSKVFNGCKKLGSIKIKSTSLKKVGKNAF
KGIAKKAVIKVPVSKLEAYKKVLAKKGQSKTVKISR

Enzyme Prediction     

No EC number prediction in MGYG000001004_01002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	52	391	1.4e-58	0.8815028901734104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	2.87e-68	54	526	8	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	4.92e-23	57	389	18	327	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.68e-20	95	390	76	326	Alpha-L-fucosidase.
sd00036	LRR_3	1.23e-17	1240	1322	47	127	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	1.04e-16	1240	1322	1	81	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB23055.1	0.0	49	1001	58	1008
QRT29448.1	0.0	49	1001	58	1008
QEI30547.1	0.0	49	1001	58	1008
PLT74914.1	9.99e-317	37	1001	47	1005
QPK81604.1	1.07e-304	19	1003	16	1006

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TR3_A	2.92e-248	37	574	9	552	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	4.61e-247	37	574	9	552	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]
6ORG_A	2.68e-108	54	527	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	3.49e-107	54	527	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	3.60e-107	54	527	8	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.29e-96	57	526	38	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	5.57e-90	57	557	40	510	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P85991	1.50e-08	978	1095	146	257	Ig-like virion protein OS=Serratia phage KSP90 OX=552528 PE=1 SV=2
P0DTR5	2.17e-08	559	661	844	948	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1
P0DTR4	2.50e-08	560	648	667	756	A type blood N-acetyl-alpha-D-galactosamine deacetylase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000398	0.998531	0.000433	0.000253	0.000196	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001004_01002.