CAZyme Information: MGYG000001001_00608

Basic Information

• Species: Prevotella sp900540375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540375
• CAZyme ID: MGYG000001001_00608
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000001001_6|CGC1	49331.7	9.6424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001001	3195691	MAG	China	Asia

• Gene Location: Start: 21118; End: 22398 Strand: +

Full Sequence      

MITIKNKYLWMVLIALLPLLPLQAQHRSVRKAKAKAAVEQKAKTLSQIFQVNDYWQKHHA
PEATAFWNVAAYHTGNMEVCKWLIQELSSNKKLSAQRRKLLTDKLNTYLSYSLRWAEHNQ
WKGATEPDTAKWLYKKYGEDQQHVLFGDWQICFQTYIDLYNMYQAQQGSKGQVLTKMEIN
DPTVMTARAREVMGYVVSHPAHDYWWWADALYMVMPVMMKMYKLTGDVRYLDKLYDNICY
SDSIMLDKETGLYFRDGKYIYPIHKTNNGKKDFWARGDGWVLAGLAKVLQDMPKSYRHYE
FLLKKYQRLALSVAQLQQPEGYWTRSMMDPHQAPGPETSGTAFFTYGMEWGVNHGLLNAE
TFKPVIRRAQNYLKTVALQSDGSVGYVQPIGERAIPGQHVDKNSQADFGVGAFLLAATES
LRIQNR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	104	421	3.1e-66	0.9006024096385542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.77e-73	46	422	8	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.97e-33	151	422	83	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84432.1	1.04e-176	40	422	6	361
QVJ79822.1	8.97e-172	51	426	33	371
ADE82673.1	4.21e-170	51	426	33	371
AGB28481.1	6.69e-169	48	426	31	380
QDW22441.1	5.17e-155	33	422	28	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.13e-149	38	422	27	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.87e-137	35	422	7	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.83e-45	205	424	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.29e-12	202	419	136	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.27e-12	202	419	126	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.17e-44	205	424	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.20e-43	205	424	157	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	9.77e-41	205	421	199	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.26e-11	202	419	136	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008703	0.985869	0.004594	0.000265	0.000253	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001001_00608.