CAZyme Information: MGYG000001001_00407

Basic Information

• Species: Prevotella sp900540375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540375
• CAZyme ID: MGYG000001001_00407
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000001001_4|CGC1	56630.36	6.4401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001001	3195691	MAG	China	Asia

• Gene Location: Start: 15865; End: 17358 Strand: +

Full Sequence      

MKNYNVLILLSLALLLMIATGCQDQADYLSNTSTTYSTTESTAETRTSTYTFYEGADLSY
VNELEDVGVKYHKDGVDIDPFTLLHSYGANIVRLRLWHNPSWTSYSTLNDVMRSMRRAKA
AGLEVLLDFHYSDTWTDPQQNIVPMAWKSVAKYSSLLSDSVYNYTYRTLEHLNSVGLLPI
IVQIGNETNFNIMVTNNNDLKPVNYARNVKLFNAGLKAVSDFNAKYGKQIKTMLHVALDP
GSAATWLARHKRYGLNYFDLFGVSYYPQWQGYTPDDLGNFASSLHTKYGTHLFVAETSQI
WTRAWNDNNHNLMSKMCTGYPDVPSPQFQKDYVTEIKEALKNNGGAGFSVWEPFWVSATN
KTLWGVGSNWENATFFDFNNDLLPHSAIEAYGDYNVKVTFEVDMYKAGSSAKGYITGDFT
DDGFGHWQIIPMHQAAKESTKYYLNTYLCRNQTGKFYFLSDSTWTAREIIDGNTQDRYFN
INTSNNWMKIAKTFGQQ

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	54	384	2.1e-85	0.97953216374269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.65e-93	53	384	1	328	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.60e-56	51	384	38	386	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB75889.1	0.0	1	497	1	497
QUB62879.1	0.0	1	497	1	497
QUB67749.1	0.0	1	497	1	497
QUB65825.1	6.04e-312	33	497	2	466
AWB69168.1	2.60e-113	47	485	23	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	2.36e-42	52	384	50	386	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	6.48e-38	52	393	24	392	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	4.47e-37	52	393	24	392	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	1.74e-32	53	388	4	328	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	4.56e-28	45	393	13	349	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48841	1.12e-90	52	384	27	360	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P48843	5.41e-42	52	390	6	348	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	2.67e-40	52	393	53	421	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q65CX5	5.60e-37	52	393	49	417	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P83692	9.52e-32	53	388	4	328	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001001_00407.