CAZyme Information: MGYG000001000_00497

Basic Information

• Species: UBA4716 sp900556575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716; UBA4716 sp900556575
• CAZyme ID: MGYG000001000_00497
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		42126.75	4.6006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001000	2124642	MAG	China	Asia

• Gene Location: Start: 597; End: 1697 Strand: -

Full Sequence      

MAKTLLPIAEKLCNTIMKDFPEIIIKKWQYDAGLCLIGFDAMYKLTGNEEYNKYIHNFYD
YFIHDDGTIETYNPEVRNIDHINCGKNLFLLLEETGDEKYAKAIELLASQLKIQPKTPSG
AYWHKNIYPNQIWLDGIFMGEPFSARYALEFNHPEKFDEVITQFEVAEKSTYEPRCGLYA
HACDESKQMFWADKNTGRSLNVWGRSVGWFCMAMVDTLDFIPEERNDIREKLIAMLNKVL
GNVVKYQDKDGVWLQVLDNSRSDNYQEATCTCQFAYAINKAINKGYVDKEVYKPHLEKAI
EGIENVFLREEGEYAYIGGCCAVAGLGPDDNPRRDGTLDYYFSEPIRDNDFKGVGPFLLL
AAEYEG

Enzyme Prediction     

No EC number prediction in MGYG000001000_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	365	6.1e-109	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.03e-103	3	365	6	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.67e-97	8	365	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO20415.1	4.54e-186	6	364	7	364
ADL43392.1	2.86e-116	11	365	15	370
ADQ05624.1	1.07e-113	11	365	15	370
AEM73046.1	2.80e-111	11	365	15	370
QDH80192.1	1.87e-107	27	365	71	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.16e-89	28	365	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.58e-70	3	365	11	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.09e-69	3	365	1	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.65e-20	28	313	65	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	1.49e-18	130	363	197	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.41e-69	3	365	11	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.16e-39	139	363	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.16e-39	139	363	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.82e-18	28	323	29	305	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001000_00497.