CAZyme Information: MGYG000000989_01408

Basic Information

• Species: Niameybacter sp900549765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900549765
• CAZyme ID: MGYG000000989_01408
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570		64959.1	4.8657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000989	3436851	MAG	Denmark	Europe

• Gene Location: Start: 2317; End: 4029 Strand: -

Full Sequence      

MLHNQFEALGLKPYGAVPSRRQMDWYRREATAFFHFGVNTFTDLEWGDGTEAEKMFNPTE
LDCRQWMRVIKQAGFTTAILTAKHHDGFCLWPSEYSEHTIAKSPYKEGKGDVVREFVEAC
HEYGIKPGLYLSPWDRHSKYWGTDAYNTYYNNQLTELMTQYGKIYECWWDGAGSTEAQYD
WGRWAYTVRTHQPDCIIFGSLGATEYVEARWVGNESGYAGNPCWATIDQSSLEIENTVEL
NSGKAGGNRFIPAEVDVSIRPGWFYHENQDGAVRSAENLVKYWFESSGRNAGILLNFPPD
RRGLIHDIDTKNVLNAATILQKTFAVNLLQGAEVSATSEMRPICSADKMLLKDENLFYAA
DEKDLTPTITFTTKEPITFNCFVLSEVIELGHRVRGYRVEAKVKDEWKVLVDNQCIGFRW
AEYFDTITTQEVRIVITDAVVAPVLRSFGVYYKPEVASVTKTVEEVVDLIAQPTTRQSVK
DNELEIEFGGIYPFNTLEMNGQGVKAYVFYAFNGTQYEKVYESKHVSAHEKATFEIQDGS
YKVKLVIDMEEGCSLENLIDGLGMKIYKSI

Enzyme Prediction     

No EC number prediction in MGYG000000989_01408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	20	318	5.6e-76	0.8554913294797688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	6.57e-69	8	451	1	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.97e-30	19	308	16	318	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.58e-30	54	308	77	316	Alpha-L-fucosidase.
pfam14871	GHL6	3.26e-04	62	140	1	77	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO77299.1	2.57e-145	13	451	27	476
ALJ40425.1	2.57e-145	13	451	27	476
QMW84652.1	2.57e-145	13	451	27	476
QUT72454.1	3.64e-145	13	451	27	476
QQA09465.1	7.29e-145	13	451	27	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	1.01e-147	9	451	1	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
6ORG_A	1.62e-103	11	454	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
5K9H_A	1.13e-102	6	458	27	470	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6OR4_A	2.46e-102	11	454	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	2.54e-102	11	454	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	9.14e-98	11	451	27	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	6.41e-94	13	451	35	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9VTJ4	1.90e-06	41	144	98	194	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q9BTY2	9.71e-06	55	179	106	237	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999853	0.000168	0.000011	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000989_01408.