CAZyme Information: MGYG000000945_01323

Basic Information

• Species: CAG-245 sp900552135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp900552135
• CAZyme ID: MGYG000000945_01323
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27563.54	5.4715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000945	1468207	MAG	United Kingdom	Europe

• Gene Location: Start: 9567; End: 10295 Strand: +

Full Sequence      

MKFIRRLLLFILIILVVVGGVFYTNGKKLYDEKLSQVSLSDKVNSLKQSEDFVYLKDLPK
QYINAVVAVEDHRYYNHGAIDPIALLRATFSNLKQKEFKEGGSTITQQTAKNLYFISEDD
VVSRKSAEAILSFTLEKEFSKDEILELYVNTIYFGNGYYGIKEACNGYLNKEPKDMTLYE
CTMLAGIPNAPSVYAPTVNFELTKKRQKKVVSSMQEYGYLTSEEASALENEIDNSTLEDL
KK

Enzyme Prediction     

No EC number prediction in MGYG000000945_01323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	47	215	7.2e-58	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	5.68e-73	48	215	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	2.06e-64	48	231	74	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.18e-62	52	231	69	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.66e-41	55	231	71	246	penicillin-binding protein 1a; Provisional
COG4953	PbpC	3.70e-39	52	229	60	237	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92252.1	3.67e-72	26	225	29	227
ANU46909.1	7.38e-72	26	225	29	227
QQQ98385.1	7.38e-72	26	225	29	227
QRP41835.1	1.05e-71	2	225	8	227
ASN93505.1	1.05e-71	2	225	8	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.64e-41	48	224	18	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.55e-41	48	224	18	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.72e-36	57	236	46	224	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	6.27e-34	53	227	43	216	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	1.98e-33	28	224	9	200	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	1.73e-42	36	241	33	229	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P38050	2.11e-42	16	225	30	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O87579	8.48e-40	48	231	66	248	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O87626	5.50e-39	48	232	66	250	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q9KNU5	7.88e-39	1	227	1	242	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.850623	0.092317	0.054025	0.000337	0.000218	0.002494

TMHMM  Annotations     

start	end
7	24