CAZyme Information: MGYG000000939_01599

Basic Information

• Species: UMGS1241 sp900540495
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UMGS1241; UMGS1241 sp900540495
• CAZyme ID: MGYG000000939_01599
• CAZy Family: CE9
• CAZyme Description: N-acetylglucosamine-6-phosphate deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		36195.82	5.1978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000939	1952721	MAG	Germany	Europe

• Gene Location: Start: 550; End: 1533 Strand: +

Full Sequence      

MDGTVEAMQGACMTHMAHGTTSLLPTTLCCSDPELFRVFAVLDEVINDKDWEGPEILGLH
LEGPYFSFNQKGAQNEAYLREPDPQHYINLLNACPYIKRMTVAPELPGALELGLELQKRK
ILASIGHTDADYEQMLLAREYGYTFITHLYSGMSALHRKNAYRHLGAVESAYLIDDFMIE
IIADGKHLPPELLRLILRNKAWDHICLITDSMRGAGMEEGSNPKLGSLKDGLDTVIFDGV
AFLPDKTSFAGSVCTADRCIKTLVQSAGIPILDAVRMMTVNPARVMNVADRKGIIRTGMD
ADLCIFDENFTILGVMTRGILHMNNCA

Enzyme Prediction     

No EC number prediction in MGYG000000939_01599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE9	1	319	1.1e-90	0.8257372654155496

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00854	NagA	6.74e-113	1	319	67	374	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
COG1820	NagA	1.39e-96	1	319	68	375	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].
TIGR00221	nagA	3.84e-71	1	319	72	379	N-acetylglucosamine-6-phosphate deacetylase. [Central intermediary metabolism, Amino sugars]
PRK11170	nagA	8.68e-52	4	319	79	376	N-acetylglucosamine-6-phosphate deacetylase; Provisional
PRK10657	PRK10657	1.69e-15	250	325	304	378	isoaspartyl dipeptidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO31105.1	3.93e-113	1	319	81	396
BCG54161.1	1.25e-109	1	319	72	389
QUT50074.1	2.44e-109	1	324	71	392
SCM59668.1	4.21e-108	1	322	74	394
BBL06394.1	4.66e-107	1	319	73	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JKU_A	7.21e-36	4	319	93	390	Crystalstructure of N-acetylglucosamine-6-phosphate deacetylase from Pasteurella Multocida [Pasteurella multocida],6JKU_B Crystal structure of N-acetylglucosamine-6-phosphate deacetylase from Pasteurella Multocida [Pasteurella multocida],6JKU_C Crystal structure of N-acetylglucosamine-6-phosphate deacetylase from Pasteurella Multocida [Pasteurella multocida],6JKU_D Crystal structure of N-acetylglucosamine-6-phosphate deacetylase from Pasteurella Multocida [Pasteurella multocida]
2VHL_A	7.34e-36	19	319	91	384	TheThree-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis],2VHL_B The Three-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis]
6FV3_A	1.11e-35	15	319	96	389	Crystalstructure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_B Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_C Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_D Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155]
1O12_A	5.20e-35	17	319	84	369	Crystalstructure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima],1O12_B Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima]
6FV4_A	1.55e-34	15	319	96	389	Thestructure of N-acetyl-D-glucosamine-6-phosphate deacetylase D267A mutant from Mycobacterium smegmatis in complex with N-acetyl-D-glucosamine-6-phosphate [Mycolicibacterium smegmatis MC2 155],6FV4_B The structure of N-acetyl-D-glucosamine-6-phosphate deacetylase D267A mutant from Mycobacterium smegmatis in complex with N-acetyl-D-glucosamine-6-phosphate [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44537	1.48e-38	4	319	77	376	N-acetylglucosamine-6-phosphate deacetylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagA PE=3 SV=1
O34450	4.02e-35	19	319	91	384	N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagA PE=1 SV=1
Q84F86	4.82e-33	1	319	72	379	N-acetylglucosamine-6-phosphate deacetylase OS=Lysinibacillus sphaericus OX=1421 GN=nagA PE=2 SV=1
Q6P0U0	1.21e-31	16	312	99	391	N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio OX=7955 GN=amdhd2 PE=2 SV=1
O32445	7.90e-31	4	324	76	378	N-acetylglucosamine-6-phosphate deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=nagA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000939_01599.