CAZyme Information: MGYG000000937_01465

Basic Information

• Species: UMGS403 sp900541975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS403; UMGS403 sp900541975
• CAZyme ID: MGYG000000937_01465
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		77001.1	3.8998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000937	2265948	MAG	Germany	Europe

• Gene Location: Start: 25676; End: 27820 Strand: +

Full Sequence      

MVKTQKKLLSLTLAGLLAVSVFLLAFVNGYIKADAANGDTVYLQAPSSWSSAYCYMWVDG
TESNNAAWPGAQMEKVEGNLYAYTIPGNFDMIIFNNGSDAGKTGDMDFPGDNKLYDFMAN
TWSDYIDSKEPAVVSSVADQTAFTTETLSVLLTLKNATSGTYSIDGGAPITFTDETTVVL
GQGKKGNTSISLLVTATDGTLNYEKTYTFTKRYKAPSAGTSDEDGHTTQALSGYFSTNPG
GQVGANKTITIDGDISDWDSSMLIAQGVANDDPRVYRPNSMYEIAVDDYALYAAWDDDNL
YLMWEMANVQDVVAPNDDFPLSQGNLWIYNLPVFLGISTDPSKTGDGSFVTAPSVWDSGI
TFTTHIDTLVAFSTNGSNGPFIYQVNDNNQFDYETANNQTGIELMWGNQTISQSLMGIDQ
AYGTYNDRIPGDTLSDSAAWVDFYAQGHDKALDMFYEMSIPLSSLGITKNDIEQSGIGLI
KISTFGTSGMDSLPYDPSMSDNADLPYSGQENNSNEKEDEDNITVPLARVGKMLSSGAAP
AEIAVDFGADKSSPQQAGTSLTLSADAYHGTAPYTYKFMVNGEVLSDSSSNTVKWTPAAP
GTYTLSVEVKDSQGESKTITKDYTISEGEIIPPPTDPKPTDPEPTDPEIMLGDLDGNGKV
DLTDVLETQKHIAAIKKLTGNAFIAADVDRNGEVDLTDVLMMQKKIANIIPDFN

Enzyme Prediction     

No EC number prediction in MGYG000000937_01465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	235	529	1.6e-109	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16738	CBM26	2.67e-14	41	98	1	60	Starch-binding module 26. CBM26 is a carbohydrate-binding module that binds starch.
cd14256	Dockerin_I	5.29e-13	651	707	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
PRK14081	PRK14081	2.33e-09	547	628	294	380	triple tyrosine motif-containing protein; Provisional
pfam00404	Dockerin_1	4.90e-09	652	706	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14252	Dockerin_like	2.36e-07	652	706	1	56	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT06902.1	1.36e-146	32	672	27	693
CDM67953.1	6.84e-123	30	625	564	1181
QCT07491.1	8.91e-101	3	536	2	531
AWX97480.1	9.74e-98	30	627	543	1160
AWX95531.1	9.74e-98	30	627	543	1160

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.205251	0.790920	0.002195	0.000848	0.000353	0.000404

TMHMM  Annotations     

start	end
9	31